(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0585

BA000012.MLR0585     Location/Qualifiers
FT   CDS_pept        434831..441274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0585"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48145"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48145"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG8"
FT                   /protein_id="BAB48145.1"
FT                   /translation="MLFSRGHAGRACVPLNLKLNSSPQEPVMARASEILFLDPSIPDLE
FT                   TALRNVRPEVDAIVLDKRQPAARQMAEALEGRNGLDAVHILAHGAPGRLGFGSGEWSSD
FT                   TLVRDAANLAAIGRALADCGGLRLWSCETGYGAAGEAFVKALSEATGAGVSAAVGLVGA
FT                   EALGGRWDLPISPMSRVAPPLTNTGTASYAGVLSLEVTLTGSLDTAGSISQKAVQYYIT
FT                   NSSNVIVASFTLPSKSSAQFSSVAMIVDVPVSGTYTITALVQDDTDDNNQWSVVSAGTF
FT                   NLSNNSVTSGPSSNSDGVFTLTGVSSTSNSGSTGPTGATGATGATGATGRTGSTGATGS
FT                   TGATGATGATGHTGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGATGATG
FT                   STGATGPTGATGATGATGSTGATGSTGATGATGSTGATGATGATGSTGATGPTGATGAT
FT                   GATGSTGATGSTGATGDTGATGSTGATGSTGATGSTGATGDTGATGSTGATGSTGSTGA
FT                   TGATGDTGATGSTGATGATGATGDTGATGSTGATGSTGDTGATGATGSTGSTGATGSTG
FT                   ATGATGDTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGAT
FT                   GSTGATGATGDTGATGSTGATGSTGSTGATGATGDTGATGSTGATGATGATGDTGATGS
FT                   TGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGATGSTGATGSTGATG
FT                   ATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGATGDTGAT
FT                   GSTGATGSTGSTGATGDTGATGSTGSTGATGATGSTGATGSTGATGATGSTGDTGATGA
FT                   TGSTGATGSTGATGSTGATGSTGATGSTGDTGATGATGSTGATGSTGATGATGATGSTG
FT                   ATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGDT
FT                   GATGATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGS
FT                   TGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATG
FT                   STGATGSTGATGSTGATGSTGATGSTGATGSTGSTGATGATGATGSTGATGSTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGS
FT                   TGATGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGASGSTGATG
FT                   STGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGATGSTGAT
FT                   GSTGATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGA
FT                   TGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTG
FT                   ATGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGAT
FT                   GSTGATGSTGATGSTGASGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGA
FT                   TGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGASGSTG
FT                   ATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGATGSTGATGSTGATGSTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGS
FT                   TGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATG
FT                   STGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGAT
FT                   GSTGATGSTGATGATGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGS
FT                   TGATGATGSTGATGSTGATGSTGATGSTGATGSTGSTGSTGATGSTGATGSTGAPGPTG
FT                   ATGATGSADDDDKHHHHHHHHGNNGNGDDDRSNRGNRRDQDDDDGKSGNGNNAKVTAST
FT                   LGLKDTTQFLQSGAPDGNSGPGKHASFGQLVGLAATSVTTDLLNVLKTVSGSGNNQNKP
FT                   SGASTDLTSDQTKPGAGYASNEHTVKTSLKDLLKPHE"
     atgctttttt cccgtggcca cgccgggcga gcctgcgtgc cgctaaacct taagttgaat        60
     tcgagcccac aggagccggt gatggcccgc gcctcggaaa tcctcttttt agatccttca       120
     atccctgatc tcgaaaccgc tctgagaaac gtgcggccgg aggtggacgc tatcgtgctc       180
     gacaaacgcc agcccgcggc gcggcaaatg gcggaggctc tagaagggcg caacgggttg       240
     gacgcggtgc acatcctagc tcacggcgcg ccgggacgtc tcggctttgg ctcgggcgag       300
     tggtcgagcg acactctggt gcgcgacgct gcgaacctag ccgccatcgg cagggccttg       360
     gccgattgtg gcggcctgcg gctgtggagc tgcgagaccg gttacggcgc ggcgggcgaa       420
     gcgtttgtaa aggctctctc cgaggcgacc ggcgctggcg tatcggctgc cgtaggactg       480
     gttggcgccg aagcgttggg cgggcgatgg gacctgccga tatcccctat gtcccgtgtt       540
     gcgccgccgc taaccaacac gggaacggca agttacgcag gtgttctgag ccttgaagtg       600
     acacttactg ggtcactcga tactgctggt tctatcagcc agaaggcagt tcagtattat       660
     atcacgaatt cgtctaacgt aattgtcgct agctttacgt taccatcaaa atcatctgct       720
     caattctctt ccgtcgctat gattgtcgac gttccagtaa gcgggactta tacgataaca       780
     gcgcttgttc aagatgatac ggacgataac aatcaatggt cagttgtttc tgctggcaca       840
     ttcaatctga gcaacaattc ggttacttct ggcccgtcca gcaattccga cggtgtcttt       900
     actcttacag gggtttcttc caccagcaac agtggttcga caggcccgac gggtgcgacc       960
     ggcgccacgg gtgcgaccgg cgccacgggc cgtacgggtt cgaccggggc tacaggctcg      1020
     accggcgcca cgggtgcgac cggcgctacg ggccatacgg gttcgacggg tgccacaggc      1080
     tcgaccggcg ccacaggctc gaccggggcg actggctcga caggtgcgac tggctcgact      1140
     ggggcaacag gcgccacagg ttcgactggg gcaaccggcg ccacgggtgc aacaggctcg      1200
     accggggcaa caggaccgac tggcgcaacc ggggccacag gtgcaacagg ctcgactggc      1260
     gcaactggct cgactggggc aacgggcgcc acaggttcga ctggggcaac cggcgccacg      1320
     ggtgcaacag gctcgaccgg ggcaacagga ccgactggcg caaccggggc cacaggtgca      1380
     acaggctcga ctggcgcaac tggctcgact ggtgcaacgg gtgataccgg agcaacagga      1440
     tcaaccggtg ccaccggctc taccggtgcc accggttcga ctggcgcaac gggtgatacg      1500
     ggagcgactg gctcgaccgg agcaactggc tcgaccggct cgaccggagc cacaggtgcg      1560
     accggcgata caggtgccac aggctcgacc ggagcgacag gtgcgaccgg ggcgactggt      1620
     gataccggag caaccggctc taccggagcg acgggttcga ccggcgacac gggtgcgacc      1680
     ggagcaactg gctcgactgg ctcgacaggt gcgactggct cgactggtgc aactggcgcc      1740
     acgggtgata cgggagcgac tggctcgacc ggagcaactg gctcgaccgg agcaactggt      1800
     tcgaccggtg ccacaggctc gacaggtgcc acaggctcga caggtgcgac tggttcgacc      1860
     ggtgcaacag gctctaccgg ggcgactggc tcgacaggtg cgactggctc gactggtgca      1920
     actggcgcca cgggtgatac gggagcgact ggctcgaccg gagccactgg ttcgaccggc      1980
     tcgaccggag ccacaggtgc gaccggcgat acaggtgcca caggctcgac cggagcgaca      2040
     ggtgcgaccg gggcgactgg tgataccgga gcaaccggct ctaccggagc gacgggttcg      2100
     accggcgcca ctggttcgac cggagcgaca ggctcgaccg gcgcgaccgg agcaaccggc      2160
     tcgaccggtg cgaccggcgc cacgggctcg accggagcaa ctggctcgac cggagcaacc      2220
     ggctcgaccg gcgccactgg ttcgaccgga gcgactggag caaccggctc gactggagca      2280
     accggctcga ccggagccac cggcgcgacc ggcgccactg gctcgaccgg agcgactggc      2340
     tcgaccggag caacaggctc gaccggagca accggctcga ctggtgcaac tggctcgact      2400
     ggtgcaactg gcgccacggg tgatacggga gcaactggct cgaccggagc aactggctcg      2460
     actggctcga ccggagcgac tggtgatacc ggcgcgacag gctccacagg ttcgacggga      2520
     gcaaccggcg cgactggctc cacaggtgcg acaggttcca ccggcgcaac tggtgcgact      2580
     ggctcgactg gtgataccgg cgcgacgggc gccacgggtt ccaccggcgc aaccggctct      2640
     accggtgcga cgggctcgac cggggcgact ggctcgactg gtgcgactgg ctcgactggt      2700
     gataccggcg cgacgggcgc cacgggttcc accggcgcaa ccggctctac cggagcgact      2760
     ggtgcgacag gcgcaaccgg ttcgaccgga gcgactggat cgaccggagc gacgggttcg      2820
     accggagcca cgggctcgac cggagcgact ggtgcgacag gctcgaccgg agcaaccggc      2880
     tcgactggtg cgacaggctc gaccggcgcc actggctcga ccggggcgac tggctcgact      2940
     ggtgcgactg gctcgactgg tgataccggc gcgacgggcg ccacgggttc caccggcgca      3000
     accggctcta ccggagcgac tggtgcgaca ggcgcaaccg gttcgaccgg agcgactgga      3060
     tcgaccggag cgacgggttc gaccggagcc acgggctcga ccggagcgac tggtgcgaca      3120
     ggctcgaccg gagcaaccgg ctcgactggt gcgacaggct cgaccggcgc cactggctcg      3180
     accggagcga ccggctcaac cggtgcgact ggatcgaccg gagccaccgg ctcgaccgga      3240
     gcgacaggct cgaccggagc aaccggctca accggggcaa ctggctcgac cggagcgaca      3300
     ggctcgaccg gagcgacagg ctcgaccggc gcaactggct cgaccggagc caccggctcg      3360
     actggtgcga ctggctcgac cggagcgacg ggttcgaccg gagcgacagg ctccacgggc      3420
     tcgaccggag caaccggcgc gaccggcgcc actggttcga ccggagcgac aggctcgacc      3480
     ggagcaaccg gctcgaccgg cgcaactggc tcgaccggag ccaccggctc gaccggcgca      3540
     actggctcga ccggagccac cggctcgacc ggagcaactg gctcgaccgg agcgactggc      3600
     tcgactggtg cgactggctc gaccggagca accggctcga ctggtgcaac tggctcgact      3660
     ggtgcaaccg gctcgaccgg agcaaccggc gcgactggct cgactggtgc gacgggttcg      3720
     accggagcaa ctggctcgac cggagcgact ggtgcgacag gctcgaccgg ggcaaccggc      3780
     tcgactggtg cgactggctc gactggtgcg acaggctcga ccggcgcaag tggctcgacc      3840
     ggagccactg gctcgaccgg cgccactggc tcgaccggag caaccggctc gactggtgca      3900
     accggctcga ccggagcaac aggttcgact ggtgcgaccg gtgcgactgg ctcgaccgga      3960
     gcgacgggtg cgaccggatc gaccggagcg acaggctcca ccggagcaac cggatcgacc      4020
     ggcgccaccg gctcgaccgg ggcaaccggc tcgacgggtg caactggctc gaccggagcg      4080
     acgggtgcga ccggggcaac cggctcgact ggtgcgactg gctcgaccgg agcgacaggc      4140
     tcgaccggag ccacgggatc gaccggagcg actggtgcga caggctcgac cggatcgacc      4200
     ggagcaaccg gtgcgactgg ctcgaccggc gcaactggct cgaccggagc cacaggttcg      4260
     accggagcaa ccggtgcgac tggctcgacc ggcgcaactg gctcgaccgg agccacaggt      4320
     tcgaccggag ccactggctc aaccggggca actggctcga ccggagcgac aggctcgacc      4380
     ggagcgaccg gagcaaccgg ctcgactggt gcaactggct cgactggtgc aaccggctcg      4440
     accggagcaa ccggcgcgac tggctcgact ggtgcgacgg gttcgaccgg agcaactggc      4500
     tcgacgggtg cgaccggctc gaccggagcg actggtgcga caggctcgac cggggcaacc      4560
     ggctcgactg gtgcgactgg ctcgactggt gcgacaggct cgaccggcgc aagtggctcg      4620
     accggagcca ctggctcgac cggcgccact ggctcgaccg gagcaaccgg ctcgaccgga      4680
     gccacgggat cgaccggagc gactggtgcg acaggctcga caggttcgac cggagccact      4740
     ggctcaaccg gtgcgacggg ttcgaccggg gcaactggct cgaccggagc gacaggctcg      4800
     accggcgcaa ctggctcgac cggagccaca ggttcgaccg gggcaaccgg ctcgactggt      4860
     gcgactggct cgactggtgc gacaggctcg accggcgcaa gtggctcgac cggagccact      4920
     ggctcgaccg gcgccactgg ctcgaccgga gcaaccggct cgaccggagc cacgggatcg      4980
     accggagcga ctggtgcgac aggctcgaca ggttcgaccg gagccactgg ctcaaccggt      5040
     gcgacgggtt cgaccggggc aactggctcg accggagcga caggctcgac cggcgcaact      5100
     ggctcgaccg gagccacagg ttcgaccgga gccactggct caaccggggc aactggctcg      5160
     accggagcga caggctcgac cggagcgaca ggctcgaccg gcgcaactgg ctcgaccgga      5220
     gccactggct cgaccggagc caccggctcg actggtgcga ctggctcgac cggagcgacg      5280
     ggttcgaccg gcgccactgg ctcgacaggt gcgacgggtt cgaccggagc gacaggctcg      5340
     accggagcaa ccggctcgac cggagcaact ggctcgaccg gagccaccgg ctcgaccggc      5400
     gcaactggct cgaccggagc caccggctcg accggcgcca ctggctcgac cggagcaacc      5460
     ggctcgactg gtgcaaccgg ctcgaccgga gcaaccggcg cgactggctc gactggtgcg      5520
     acgggttcga ccggcgccac tggctcgacc ggagcaaccg gctcgactgg tgcaaccggc      5580
     tcgaccggag caaccggcgc gactggctcg actggtgcga cgggttcgac cggagccact      5640
     ggctcgaccg gagcgacggg tgcgaccggg gcaaccggct cgactggtgc aaccggctcg      5700
     accggcgcga ctggctcgac cggcgcaacc ggcgcgacgg gttcgaccgg ggcaactgga      5760
     gcgactggct cgaccggcgc gactggctcg accggctcga ccggagcgac gggtgcgacc      5820
     ggctcgactg gcgccacggg ctcgaccgga gcgacgggtt cgaccggagc aactggctcg      5880
     actggtgcga caggctcgac tggctcgact ggctcgaccg gagcgacagg ctcgactggt      5940
     gcgaccggct cgaccggagc gcctggtccg accggtgcga ccggtgcgac tggctcagcc      6000
     gatgacgatg ataagcatca tcatcaccat caccaccatg gcaacaacgg caacggcgac      6060
     gacgaccgca gcaaccgagg caaccggcgt gaccaggacg acgacgatgg caagtccggc      6120
     aacggcaaca acgccaaagt cacggcaagc acgctcgggc tcaaggacac cacacagttc      6180
     ctgcagtccg gcgcgcccga cggcaacagt ggtcccggca agcatgcgtc gttcggccaa      6240
     ctggtcggcc ttgcggcgac ttcggtgacg acagacctgc tgaacgttct caagacggtt      6300
     agcggatctg gcaacaacca gaacaagccg tctggggcga gcacggatct cacctcggat      6360
     cagaccaagc ctggcgccgg ctatgccagc aacgagcaca ccgtcaagac gtccctgaag      6420
     gatctcttga agccgcacga gtga                                             6444
//

If you have problems or comments...

PBIL Back to PBIL home page