(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0587

BA000012.MLR0587     Location/Qualifiers
FT   CDS_pept        441759..451196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0587"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48146"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48146"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG7"
FT                   /protein_id="BAB48146.1"
FT                   /translation="MRRRVYVCPRRKADVPIPEFTREFAVEASAARVMGVGTVNQALSR
FT                   APQGVVPRFDGRQIHPLPATATGRPNARTDAPLPRASEILFVDPSVSDLGTILANLRPE
FT                   VEAILLDAKRPAARQMALALEGRDGLDAVHVIAHGAPGRVSFAAGEWSARTLDDDGVDL
FT                   AAIGRALGDDGGLRLWSCYAAAGDEGDEFVDGLARATGTNVAAATGLIGAAARGGGWQL
FT                   ARRVRGAVVAQPPLTAGGIGAYAGVLVARTWVGGVDTNFLNVNNWSVTTGSIGADVLTI
FT                   SGSPTRQPTLSTAGTTTITSLNISGSNTLTINGAAVILAATSGITMASPAIITGTGTIA
FT                   AGTNITGAGTVGIPISTTGTITASGGTLNLTGTVSNRTLAIANVAGSILKLDGTVSSGV
FT                   TFNGTTGTLDLTNLAGFTGTISGLNIGASTTTATNQIDFGNASIVSGSLNGSVLTVVDG
FT                   AGQSYALTLGGAPAAGTVVDLKFDGASGTDVFFSTPAATNTFTMAQGGADAWGDTARWS
FT                   GGLPLTQPAAGPNLTFVSNHNAQGSLSGNINSLYMPPTLRQATGTGSSIWTVSDTGSSA
FT                   NQFTTSLTLINHGQIFVNGTANLTSGTAATTNWVMTGTGVGAGGLGNQYFENDGSLNVV
FT                   GTTAAALANGFSTSATFTGNIYVTGSGYMNIYGNASLVFGTGVGVSASQTINFVTDGGN
FT                   NTDGTVTEISSQFVNAAYAGFLPGDTLVLENLGATPLSEVVIDGNGQATVYIYSGANGT
FT                   GTLLDEETFLGNFTNGNSDFTFVNSSANGGQVTIGATGSAGHAVGPTGPTGPTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGATGATGSTGATGATGSTGATGSTGATGSTGA
FT                   TGATGATGSTGATGATGSTGATGATGSTGATGSTGVTGATGSTGATGATGATGSTGATG
FT                   STGNTGATGSTGATGATGATGDTGATGSTGATGSTGATGATGDTGATGSTGATGSTGAT
FT                   GATGDTGATGSTGATGATGATGDTGATGSTGATGSTGATGDTGATGSTGATGATGATGD
FT                   TGATGSTGATGATGATGATGATGDTGATGSTGATGATGDTGATGSTGATGSTGATGDTG
FT                   TTGSTGATGATGATGDTGATGATGATGSTGATGATGATGDTGATGSTGATGATGATGDT
FT                   GATGDTGVTGSTGATGATGATGATGDTGATGSTGATGATGSTGTTGATGATGDTGATGD
FT                   TGATGSTGATGATGATGDTGATGSTGATGSTGATGATGDTGATGSTGDTGATGATGATG
FT                   ATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGATGDTGATGATGATGAT
FT                   GATGDTGATGSTGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGD
FT                   TGATGSTGATGATGATGDTGATGSTGATGSTGATGDTGATGSTGATGATGDTGATGSTG
FT                   ATGATGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGSTGAT
FT                   GATGATGDTGATGSTGATGATGATGATGATGDTGATGSTGATGATGATGDTGATGSTGA
FT                   TGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATG
FT                   ATGATGDTGATGSTGATGSTGATGDTGATGATGATGDTGATGATGATGATGATGDTGAT
FT                   GATGSTGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGATGDTGATGS
FT                   TGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGDTGATGSTGATGATG
FT                   ATGATGATGDTGATGSTGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGAT
FT                   GATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGD
FT                   TGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATG
FT                   STGATGATGSTGDTGATGSTGATGVTGATGDTGATGATGATGATGATGSTGATGATGST
FT                   GDTGATGATGDTGATGSTGATGSTGATGATGATGATGATGDTGATGSTGDTGATGSTGA
FT                   TGATGATGATGATGATGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATG
FT                   ATGDTGATGSTGATGSTGATGDTGATGSTGATGATGDTGATGSTGATGATGSTGATGAT
FT                   GDTGATGSTGATGDTGATGSTGATGATGDTGATGSTGATGATGATGATGATGDTGATGS
FT                   TGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATG
FT                   STGATGDTGATGSTGATGSTGDTGATGSTGATGATGATGVTGDRGATGSTGATGSTGAT
FT                   GATGATGASGATGDTGATGSTGATGATGDTGATGSTGATGDTGATGSTGATGDTGATGS
FT                   TGATGATGSAGATGATGATGDTGATGSTGATGATGATGDTGATGATGDTGATGSTGATG
FT                   STGATGDTGATGSTGATGSTGATGATGATGASGPTGDTGATGSTGATGATGDTGSTGAT
FT                   GSTGATGDTGATGSTGATGATGAPGATGATGDTGATGSTGDTGATGSTGATGATGDTGA
FT                   TGSTGATGATGSAGATGSTGATGATGATGNTGATGSTGATGSTGATGATGSTGPKGDTG
FT                   STGSTGPKGDTGPKGATGATGATGSTGATGPKGDTGPKGDTGPKGATGATGATGSTGST
FT                   GPTGSTGPKGDTGPKGATGATGATGSTGSTGPKGDTGPKGATGATGATGSTGSTGPTGS
FT                   TGPKGDTGPKGATGATGATGSTGSTGPTGSTGPKGDTGPKGATGATGATGSTGSTGPTG
FT                   STGPKGDTGPKGATGATGATGSTGSTGPTGSTGPKGDTGPKGATGATGATGSTGSTGPT
FT                   GSTGPKGDTGPKGATGATGATGSTGSTGPTGSTGPKGDTGPKGATGATGATGSTGATGP
FT                   KGDTGPKGDTGPKGATGATGATGPTGPSSGHHDSIVPSTSTLVTTTQKTANVTSDSLGL
FT                   KDSGQFLQPGSTGNGSGGQPSLHHLIGLAAGSVTTDLLNILNTIKGFGHQQNQPSRATT
FT                   DQTLDATKHGTGYASTDHTAKTTLKDLLKPHE"
     gtgagacgcc gcgtctatgt ctgtcctcgg cggaaggcag acgtccccat tccggagttc        60
     actcgcgagt ttgccgtcga ggcgtcggcg gcacgggtga tgggagtggg tactgtgaat       120
     caagcgttgt cgcgtgcgcc ccagggcgtt gtgccccggt tcgatgggcg ccaaattcat       180
     ccgctgccgg ccacagcaac tggtcgcccg aatgcgcgga ccgatgcgcc cctgccccgc       240
     gcttccgaaa tccttttcgt cgacccctct gtatccgatc tcggcacgat cctcgccaat       300
     ctgaggcccg aggtcgaggc gatcctgctc gacgccaagc gcccggccgc gcgccagatg       360
     gcgctggcgc tcgaaggccg cgacggcctc gatgccgtgc acgtcatcgc gcatggggcg       420
     ccagggcggg tgagcttcgc ggcgggtgaa tggtcggcgc ggacgctgga cgacgacggg       480
     gtcgacctcg cggcgatcgg ccgggcgcta ggcgatgatg gcggtttgag gttatggagc       540
     tgctatgctg ctgccggcga tgagggtgat gaattcgtcg atggcctggc gcgcgcaacc       600
     ggcacgaacg ttgccgccgc gacgggactt atcggtgcag cggcacgggg cggcggatgg       660
     caactcgcca gacgtgtaag aggtgccgta gtagcacagc cgccgctgac tgcggggggc       720
     atcggcgcat atgccggggt gttggtcgcc aggacgtggg ttgggggtgt cgacactaat       780
     ttcctcaacg tcaacaactg gagcgtgaca actggctcaa ttggtgcgga cgttctaacc       840
     atctcgggga gcccaaccag acagcccacg ctgagcaccg ctggcaccac cacaataact       900
     tcactgaaca tcagcggctc caacactcta accattaatg gtgcagccgt tattctcgcc       960
     gcgacaagcg gcatcactat ggccagccca gccatcatca cgggcactgg cacgatcgca      1020
     gcaggcacta acatcactgg cgccggcacc gtaggcatac cgatatcgac caccggcaca      1080
     atcacagcca gcggcggcac actgaacctt accggaaccg tgtcgaatcg gacgctggca      1140
     atcgccaatg ttgccggatc gattctcaaa ctcgacggca ccgtgagctc cggggttacc      1200
     tttaacggta ccaccgggac tctggacctc accaacctcg cagggttcac cggcaccatc      1260
     agcgggctga acatcggcgc cagcaccacc acggcgacca accagatcga ttttggcaat      1320
     gccagcattg tatcgggaag cctgaatggc agcgtcctca cagtcgtaga cggcgccggt      1380
     cagtcgtacg cgttgacact cggcggcgct ccagccgccg gcacagttgt cgatttgaag      1440
     tttgatggag ctagcggcac tgacgtcttc ttcagcacgc cggcagcgac gaacaccttc      1500
     acaatggccc agggaggggc cgacgcctgg ggggatacgg ctcgatggag cggcggctta      1560
     cctctgactc agccggccgc cggccccaat ttgacgttcg tcagcaacca caatgctcag      1620
     ggcagtttat cgggcaatat taattcctta tacatgccgc cgaccctgcg tcaggcaacg      1680
     ggaaccggta gcagtatctg gaccgtcagt gacacgggct ccagcgccaa ccaatttacc      1740
     acctcgctga ccctgatcaa ccatggtcag attttcgtaa acggcaccgc aaacctgacg      1800
     tcgggcacag cggcgacgac caattgggtc atgactggca ccggcgtcgg ggcgggcggc      1860
     ctcggcaatc aatatttcga aaatgacggc tccctcaacg tcgtaggcac gacagcggcc      1920
     gctctcgcga acggcttctc aacctccgcg actttcaccg gcaatattta tgtaaccggc      1980
     agcgggtaca tgaatatata cggcaacgcg tcgctagtgt tcggtactgg cgttggcgtg      2040
     agcgcgagcc agacgattaa ttttgttacc gacggcggta ataatacaga tggtacagtt      2100
     actgaaatca gctcccaatt tgtcaatgcg gcatacgcgg gatttctccc gggcgataca      2160
     ttagtcctgg agaatttggg ggctaccccc ctctccgagg tcgtgattga cggcaatggc      2220
     caggcgacgg tctacatata tagcggcgcg aacggcacgg gcactttgct cgatgaggaa      2280
     acattcctcg gcaattttac caacggcaac agcgacttca ccttcgttaa cagctccgcc      2340
     aatggcggac aggttacgat aggcgctacc ggatccgcag gccatgcagt cgggccgaca      2400
     ggtccgacag gtccgactgg cgctacgggt tcaacgggcg ccacgggctc gaccggcgct      2460
     acaggttcga ctggtgcgac gggttcgact ggcgcgacgg gttcgaccgg tgcaacgggt      2520
     gcgaccggcg ccacgggttc aacgggcgcc acgggcgcga ctggctcaac cggcgcgacg      2580
     ggttctactg gcgccacggg ctcgaccggt gcaacgggtg cgaccggcgc cacaggctca      2640
     acgggcgcca caggtgcgac tggctcaacc ggcgccacgg gcgcgactgg ctcaaccggc      2700
     gcgacgggtt cgacaggcgt tacaggcgcg acgggctcga ctggtgcaac cggagccaca      2760
     ggtgcgaccg gctctactgg tgccacgggt tcgaccggca atacaggcgc cacgggttca      2820
     accggcgcca caggcgcgac tggtgctacc ggcgatacag gcgccacagg ttcgaccgga      2880
     gctaccggct cgaccggagc aactggcgcc actggcgata ccggagcgac aggttcgact      2940
     ggagcaactg gctcgaccgg tgccacaggc gcgaccggcg acaccggagc cacaggttcg      3000
     actggagcaa ccggagccac aggtgcgacc ggcgatacgg gtgccactgg ttcgactgga      3060
     gctacaggtt caacaggcgc gaccggtgat accggagcca cgggctcgac cggtgcaacc      3120
     ggcgccactg gcgcgaccgg tgataccgga gccacgggct cgaccggtgc aaccggcgcc      3180
     acaggtgcga ccggagccac aggtgcgact ggcgatacgg gcgccacggg ttcgaccgga      3240
     gcaactggcg cgaccggtga taccggcgcc acaggctcta ctggagctac aggttccact      3300
     ggcgcaaccg gtgatacggg caccacaggc tctactggag caaccggcgc cactggtgcg      3360
     actggcgata cgggcgccac cggagctacc ggcgccacgg gctcgaccgg agcaaccggt      3420
     gccactggtg cgaccggcga tacaggcgca acgggttcca caggagcaac cggcgccaca      3480
     ggtgcaactg gcgacaccgg cgcaaccggc gatacgggtg tcacaggctc gaccggagcc      3540
     acgggtgcaa ccggagccac aggcgcgacc ggggataccg gcgccacggg ttccaccggt      3600
     gccacgggcg ccacgggttc gaccggaaca accggagcca caggcgcgac cggcgatacc      3660
     ggagcgaccg gcgataccgg ggccacggga tctactggcg caaccggtgc cacaggtgcg      3720
     accggcgata ccggtgccac aggttcaacg ggagcgacgg gctcgaccgg agccacaggc      3780
     gcgactgggg atacgggcgc cacgggctcg accggcgata cgggcgccac cggagccacg      3840
     ggcgcaactg gtgctacagg tgcaactggc gatacgggcg ccacgggttc gaccggagct      3900
     accggagcca ctggtgccac aggcgatacc ggagccacgg gctcgaccgg ggcaaccggt      3960
     gccacaggtg caactggcgc gaccggtgat accggcgcca cgggtgcgac cggagctacc      4020
     ggcgccactg gtgccacagg cgataccgga gcaacaggtt cgactggggc cacaggctca      4080
     actggtgcga ccggtgatac cggcgccaca ggctcgaccg gagcaaccgg agccacgggt      4140
     gcaaccggcg atacgggcgc cacaggctct accggagcaa ccggtgctac gggcgcaacc      4200
     ggcgatacgg gcgccacggg ttcgaccgga gctaccggcg ccactggtgc cacaggcgat      4260
     accggagcaa caggttcgac tggggccaca ggctcaactg gtgcgactgg tgataccggc      4320
     gccacaggtt ccaccggagc aaccggagcc actggtgata ccggcgccac aggttcgacc      4380
     ggagccaccg gtgcgactgg tgcgacaggc tcgaccggcg cgaccggcga taccggagca      4440
     acgggctcta ctggagcaac cggagccacg ggcgcgaccg gtgataccgg tgcgactggc      4500
     tcgactggag caaccggcgc cacaggcgcc accggcgata cgggttcgac cggagctacc      4560
     ggagccactg gcgccaccgg cgataccgga gccacgggct cgaccggtgc aaccggcgcc      4620
     acaggtgcga ccggagccac aggggcgact ggcgatacgg gcgccacggg ttcaaccgga      4680
     gcaaccggcg ccacaggcgc gaccggggat accggagcca cgggttccac cggagccacg      4740
     ggtgcgaccg gcgacaccgg tgcaacgggc tcgactggag caaccggagc aacaggtgcg      4800
     accggcgata cgggtgccac aggctcaacc ggagctacag gtgctacggg tgcgaccggc      4860
     gatacgggcg ccaccggctc gaccggagca accggagcca ccggtgcaac tggcgccacg      4920
     ggtgcgactg gcgatacggg tgccaccggt tcaactggag ctacaggttc aactggcgcc      4980
     acaggcgata ccggcgccac cggcgccaca ggtgcgaccg gcgatacggg cgccacaggt      5040
     gcgaccggag ctaccggcgc cacgggtgcg actggcgata cgggcgccac gggtgcgacc      5100
     ggctcgactg gagcaactgg cgccaccggc gatacgggcg caacgggctc gactggagca      5160
     accggcgcca caggtgcgac cggcgatacg ggtgccactg gttcgaccgg agcaactgga      5220
     gctaccggcg ccacaggtgc gaccggcgac accggtgcca ccggctctac tggcgcaacc      5280
     ggagccactg gcgcgactgg tgataccggc gccacgggct cgacgggagc taccggcgcc      5340
     acaggtgcga ccggcgacac cggtgcaacg ggctcgactg gcgcaactgg cgccactggc      5400
     gataccggag cgacaggttc gactggcgca accggagcca cgggcgcgac cggtgccacg      5460
     ggtgcgaccg gcgatacggg cgccaccggt tcgaccggag caaccggctc aacaggtgcg      5520
     actggagata ctggcgcgac cggctcgact ggagcaactg gcgccacggg tgcgaccggc      5580
     gatacgggcg caacgggctc gactggtgca accggagcca cgggcgcgac cggtgatacc      5640
     ggtgcgactg gctcgactgg agcaaccggc gccacaggcg ccaccggcga tacgggtgcc      5700
     acgggctcga ctggagctac cggtgccact ggtgccacag gcgataccgg cgccacgggt      5760
     tcgactggtg caaccggcgc cacaggtgcg accggtgata caggcgccac gggttcgacc      5820
     ggagctaccg gcgccacggg tgcaactggc gatactggag ccacgggctc gactggagct      5880
     accggtgcca ctggtgccac aggcgatacc ggcgccacgg gttcgacagg agcaaccggt      5940
     gccacaggtg cgaccggcga tacaggcgcc acgggttcga ccggagctac cggcgccacg      6000
     ggttcgactg gcgatactgg agccacgggc tcgactggag ctaccggcgt cacaggtgca      6060
     actggcgata ccggagccac gggtgcaacc ggtgccacgg gcgcgacggg cgccacgggt      6120
     tcgactggcg caaccggtgc caccggctcg accggtgata caggcgccac aggtgcgacc      6180
     ggcgatacgg gcgcaacggg ctcgactgga gccacgggtt ccaccggagc gaccggtgct      6240
     acgggtgcaa ccggcgccac aggtgcgact ggcgatacgg gcgccacagg ttcgactggc      6300
     gatacgggcg ccacaggttc gaccggcgca accggagcca cgggtgcgac tggcgcaacc      6360
     ggagccacgg gtgcgactgg cgcaaccgga gccacgggtg cgactggcga tactggggca      6420
     acgggctcga ccggagcaac tggagccacc ggcgcaaccg gtgatacggg cgccacgggc      6480
     tcgactggag caactggagc cacaggtgcg actggcgata cgggcgccac gggttcgact      6540
     ggagctacag gttcaacagg tgcgactgga gatacaggcg cgaccggctc gactggagca      6600
     actggcgcca ccggcgatac gggtgcaacg ggctctactg gcgcaaccgg agccacgggt      6660
     tccaccggcg ccacgggtgc gaccggcgac accggtgcaa cgggctcgac tggggcaacg      6720
     ggcgatacgg gagcaacagg ttcaaccgga gcaacaggtg cgaccggcga tacgggcgct      6780
     acgggctcga ctggagcgac cggtgctacg ggcgcaaccg gcgccacagg tgcaacgggc      6840
     gataccggag caacaggttc gactggggct acaggttcaa ctggtgcgac cggtgatacg      6900
     ggcgccacgg gttcgaccgg agctaccggc gccacaggtg cgactggcga tacgggggct      6960
     acaggctcga ccggggcaac tggtgccacg ggtgcgactg gcgataccgg agcaacaggt      7020
     tcgactgggg ctacaggctc aacaggcgcg accggcgata ccggcgccac gggctcgacc      7080
     ggagccacgg gttcgaccgg cgatacgggt gccactggtt cgaccggagc aactggagca      7140
     accggcgcca caggtgtgac cggcgatagg ggcgcaacgg gctcgactgg agccacgggt      7200
     tccaccggag cgaccggtgc tacgggtgca accggagcct caggtgcgac cggcgatacc      7260
     ggagccacgg gctcgaccgg agctaccggc gcaaccggtg atacgggcgc cacgggttcg      7320
     acaggtgcga ctggcgatac aggcgcgacc ggctcgactg gagcaactgg cgatacgggc      7380
     gccacgggct cgactggagc tacgggcgcc acaggttcgg ctggagcaac tggagccaca      7440
     ggtgcgactg gcgatacggg tgccacaggc tcaaccggag ctaccggcgc cactggtgcg      7500
     accggcgata ccggcgccac tggtgcgacc ggcgataccg gcgccacggg ctcgaccgga      7560
     gctacaggtt caacaggtgc gactggagat acaggcgcca ccggctcgac tggagccacg      7620
     ggttccaccg gagcgaccgg tgctacgggt gcaaccggag cctcaggtcc gaccggcgat      7680
     accggagcca cgggctcgac tggggcaact ggcgcgaccg gcgatacggg ttcgaccgga      7740
     gctactggct caacaggtgc gactggagat accggcgcga ccggctcgac cggagcaact      7800
     ggagctaccg gagccccagg tgcgaccggc gcaaccggtg acacgggcgc aacggggtcg      7860
     actggcgata ccggagccac gggttcgacc ggggcaaccg gcgccactgg cgatactggt      7920
     gccaccggct caaccggagc gaccggtgct acgggttccg ccggcgccac cggttcgact      7980
     ggagcaaccg gcgccactgg tgcgactggc aatacgggcg ctacaggctc tactggagcg      8040
     acaggttcga ccggagcaac cggcgcaacg ggctcgacag gaccgaaggg tgacaccggc      8100
     tcgactggct caaccgggcc caagggcgac accggaccga agggtgccac gggtgcaacc      8160
     ggcgccacgg gctcgaccgg agcaaccgga ccgaagggtg atactggacc taagggcgac      8220
     accggaccca agggcgcaac aggtgccact ggcgcaaccg gctcgactgg ttcgaccggt      8280
     ccgactggct caaccggacc taagggcgac accgggccca agggcgcgac aggtgccact      8340
     ggcgcaaccg gctcgactgg ttcgaccggg cccaaaggcg acaccgggcc caagggcgcg      8400
     actggtgcaa ccggcgccac aggctcaact ggttcgaccg ggccgactgg ctcaaccgga      8460
     cctaagggcg ataccgggcc taagggcgca acaggtgcca ctggcgcaac cggctcgact      8520
     ggttcgaccg gtccgactgg ctcaaccgga cctaagggcg acaccggacc caagggcgca      8580
     acaggtgcca ctggcgcaac cggctcgact ggttcgaccg gtccgactgg ctcaaccggg      8640
     cctaagggcg acaccgggcc caagggcgcg actggtgcaa ccggcgccac aggctcaact      8700
     ggttcgaccg gtccgactgg ctcaaccgga cctaagggcg acaccgggcc taagggcgcg      8760
     actggtgcaa ccggcgccac aggctcaact ggttcgaccg gtccgactgg ctcaaccgga      8820
     cctaagggcg ataccgggcc taagggcgcg acaggtgcaa ccggcgccac aggctcaact      8880
     ggctcgaccg gtccgactgg ctcaaccggg cctaagggcg acaccggccc caagggcgcg      8940
     accggtgcaa ccggcgccac gggctcgacc ggagcgaccg ggccgaaggg cgatactgga      9000
     cccaagggcg atactggacc caagggcgcc acaggtgcca ccggcgcaac cggtccgacc      9060
     ggaccctcaa gcggtcacca cgactcgatc gttccgtcga cctcaaccct ggtgacgacg      9120
     acccagaaga ccgccaatgt cacgtccgac tcgctcggcc tcaaggatag cgggcagttc      9180
     ctgcagccgg gctcgaccgg caatggcagc ggcggccagc cgtcgctaca ccacctgatc      9240
     ggcctagcgg ccggctcggt gacgaccgat ctcctgaata tcctcaatac gatcaaggga      9300
     tttggtcacc aacagaacca gccgtcccgc gcgactacgg accagacctt ggatgcgacc      9360
     aagcacggta ccggctacgc cagcaccgac cacacggcga agacgaccct gaaggatctt      9420
     ctgaagccac atgagtga                                                    9438
//

If you have problems or comments...

PBIL Back to PBIL home page