(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0588

BA000012.MLR0588     Location/Qualifiers
FT   CDS_pept        451554..453698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0588"
FT                   /product="probable secretion ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48147"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48147"
FT                   /db_xref="GOA:Q98MG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG6"
FT                   /protein_id="BAB48147.1"
FT                   /translation="MLRAARYHGVELDPNEFRAASAVPAAADLSQWAQDAGMWSRAVRI
FT                   RWSHLLRFQDAGPVVLLFNDGGAALLTGASAERNVVFLKSADAPEDGEAVAIDELRLSQ
FT                   VWTGEALLLRATRSYVAADAPFTLRWLAELVRLESHALRDITIASFTLSVLTILPPLIV
FT                   MTVVNKVLQFNSISTLVLLSAVIAVVFAYETLLGHARRLIINVVGARLDTKLQLHVFSR
FT                   LLRLPLDYFERHPAGETMYHLAQVYRIREFLTGKLLSTFLDMITLCVLVPVMFYINTAL
FT                   AWIVLACAVVIMLIILAFLMPLRRRYQRVVDAETWKSAALGETVVGIKTVKALGLEPQR
FT                   KALWDERVAEAGKARLAFGQLASWPQTLVTPIERVMVLGTMLIGAYLAMNDRTGYMVGG
FT                   LFAFMMIAQRVAQPLVGLARLVEDYEEVGAAIGEAASVLNRPLESSSNSTGLRPRLVGE
FT                   VVFSDLTFSYIATKIPALDRVSFHIPAGSMFGIVGRSGSGKSTVARLLQGINRDYSGFL
FT                   KLDGVDLKEINLRHLRQGLGVVLQDNFLFRGSIRDNIIAGRPGLTLSDAMRAAHLAGAQ
FT                   EFIERMPNGYDTYIEEGSPNLSGGQKQRLAIARALIHDPTILILDEATSALDPESEAVV
FT                   SANLMRIASGRTMIIVSHRLASLTECDNILVMDQGKVLDVAPHATLLERCALYRQLWSQ
FT                   QNRHLDGRHGRPVAVPPRLV"
     atgctgcgcg ccgcccgcta tcacggtgtc gagctcgacc cgaacgaatt cagggccgcg        60
     agcgcggttc cggccgccgc cgatctgtcg cagtgggcgc aggacgccgg catgtggtca       120
     cgtgctgtgc gcatccgctg gtcgcacctt ttgcgcttcc aggacgccgg accggtcgtc       180
     ctgttgttca acgacggcgg cgcggctctc ctcaccgggg cgagcgccga gcgaaacgtc       240
     gtcttcctga aaagtgcgga tgcacccgaa gatggtgaag ccgtcgccat cgacgagttg       300
     cggctgtcgc aggtgtggac cggcgaggca ctgctgctgc gcgccacacg atcctatgtc       360
     gcggcggacg cgcccttcac ccttcgctgg ctcgccgaac tggtgcggct cgaaagtcac       420
     gctctgcgcg atatcaccat cgcctcgttc acgctgagtg tccttaccat cctgccgccg       480
     cttatcgtca tgacggtggt caacaaggtg ctgcagttca acagcatttc gacgctggtg       540
     ctgttgtcgg cggtgatcgc cgtggttttc gcctatgaga cactgcttgg ccatgcacgg       600
     cggctgatca tcaatgtcgt cggcgcccgt ttggatacca agttgcagct gcacgtcttc       660
     agccggctgt tacgcctgcc gctcgactat ttcgaacggc atccggccgg cgagacgatg       720
     tatcacctcg cccaggtcta tcgcatccgc gagttcctga cgggaaaact cctcagcacg       780
     ttcctggata tgatcacgct gtgcgtgctg gtaccggtca tgttctacat caacaccgcc       840
     ctcgcctgga tcgtgctggc ctgcgcggtg gtgatcatgc tgatcatcct cgccttcctc       900
     atgccgctgc gccgcagata ccagcgagta gtagacgccg agacctggaa gtcggcggcg       960
     ctcggcgaaa cagtcgtcgg catcaagacg gtgaaggcgc tcggtctcga gccgcagcgc      1020
     aaggcgcttt gggacgagcg ggtggcggaa gcgggaaagg cgcgtctcgc cttcggacag      1080
     ctggcaagct ggccgcagac cctggtcacg ccgatcgaac gcgtgatggt gctcggcacc      1140
     atgctgatcg gcgcctatct cgcgatgaac gaccgcaccg gctacatggt cggcggcttg      1200
     ttcgccttca tgatgatcgc ccagcgtgtg gcccagccgc tggttggcct ggcccgattg      1260
     gttgaagact acgaggaggt cggtgcggcg atcggcgagg cagcgtcagt cctcaaccgg      1320
     ccgctggaga gcagttcgaa ttccaccggc ctgagaccca ggctggtcgg cgaggtcgtg      1380
     ttcagcgacc tgacctttag ctatatcgcc accaagatac cggcgctcga ccgggtcagc      1440
     ttccacattc ccgccggcag catgtttggc attgttgggc gcagcgggtc gggaaaatcg      1500
     acagtcgccc gcctcctgca ggggatcaac cgcgactaca gtggtttcct caagcttgat      1560
     ggcgtcgacc tcaaggaaat caacctgcgc catctgcgcc aggggcttgg cgtggtgctg      1620
     caggacaact ttctgttccg cgggtcgatc cgcgacaaca tcatcgccgg gcgcccgggc      1680
     ctgacgcttt ccgacgccat gcgcgccgcg cacctcgccg gcgcccagga attcatcgag      1740
     cggatgccga atggctacga cacctacatc gaggaaggtt cgcccaatct gtcaggcggt      1800
     cagaagcagc ggctggcgat cgcgcgcgcg ctcatccacg atccgactat tctcatcctc      1860
     gacgaagcga ccagcgcact cgacccggag agcgaggcgg ttgtcagcgc caacctcatg      1920
     cgcatcgcca gcgggcgcac gatgatcatc gtttcgcacc ggctcgcctc gctgaccgag      1980
     tgcgacaaca tcctcgtcat ggatcagggt aaggtcctcg acgtcgcgcc gcatgcgacc      2040
     ttgctcgaac gatgtgcact ctatcgccag ttgtggtcgc agcagaaccg gcacctcgac      2100
     ggccgccacg gccgcccggt cgccgtcccg ccgcggttgg tttga                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page