(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0589

BA000012.MLR0589     Location/Qualifiers
FT   CDS_pept        453740..455146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0589"
FT                   /product="probable secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48148"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48148"
FT                   /db_xref="GOA:Q98MG5"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG5"
FT                   /protein_id="BAB48148.1"
FT                   /translation="MSSTSLTALPARWHRMETRDPTAPAILEFQWPSTAVANAPIPRSA
FT                   RGIVWIVSSLVIALIALAGLIPVDQVVTARGLVVSQSPNIVVQPLETAIVRSIEVREGQ
FT                   RVQAGQLLARLDATFTSADKAALAMQVSTLEAEVARLKAEANGQAFTYDGLDPSWTLQV
FT                   SIFEQRKAVYDAKVENFERQRDELSSVISRSQSDAEGYRQRLTVADSIEQMRRQLEARQ
FT                   VGSRLNTLLAEDNRAEMSRALGNAEQTAEAAKRQQAAVAAERDGYIQGWRAEVSQSLSE
FT                   ASSRISDARELLNKAKLRNQLVELKSQSDAIVQSVAKVSVGSVMQSGERFITLVPADAP
FT                   LEIETNIVGRSSGFVHVGDPVVIKFDTFPYSQYGLAHGTVRALSPDSFSAQEQARDPNS
FT                   SLAMLPSDAEPFYRTRISIDQVALHGVPAGFAVSPGMPVTADVKVGRRTILKYILGVML
FT                   PIGQEAMREP"
     atgagcagca cctccctcac cgcccttccc gctcggtggc accggatgga aacgagagat        60
     ccgacggcgc cggcaatact cgagttccag tggccatcga cggctgtcgc caatgcgcct       120
     attccgcggt cggcgcgcgg catcgtctgg atcgtctcta gcctggtcat cgcgctgatc       180
     gccctggcgg ggctgatacc ggtcgatcag gtggtgacgg ccagagggct ggtggtctcg       240
     caatccccca acatcgttgt gcaaccgctg gaaacagcga tcgtccgctc gatcgaggtg       300
     cgggaaggac agcgcgtcca ggccggccaa ttgcttgccc gcctcgatgc gacctttacc       360
     tcagccgaca aggcggcgct ggcgatgcag gtctcgacgc ttgaagccga ggtggcgcgg       420
     ttgaaggcgg aggccaacgg ccaggcgttc acctatgacg gcctcgaccc gagttggacc       480
     ctgcaggtgt cgatattcga gcaacgcaag gcggtctacg acgccaaggt ggagaatttc       540
     gaacgccagc gtgacgaact cagctcggtg atttcgcgat cgcaatccga tgcggagggc       600
     taccgccagc ggctcacggt cgccgactcg atcgaacaga tgcgcaggca gcttgaggca       660
     aggcaggtag gaagtcgcct caacacgctc ctggccgagg acaaccgggc ggaaatgtcc       720
     cgggcgctgg gcaatgccga acagaccgcg gaagccgcca agcgccagca agccgcggtg       780
     gccgccgagc gcgacggcta cattcagggc tggcgcgctg aagtctcgca gagcctgtcc       840
     gaggcgagct cgcggatctc ggacgcccgc gaacttctca acaaggcaaa gcttcgaaac       900
     cagttggtcg agttgaagag ccaatcagac gccatcgttc aatccgtggc aaaagtctct       960
     gtcggctcgg tcatgcagtc aggggagcgc tttatcacgc tggtgccggc cgacgcgccc      1020
     cttgagatcg agacaaacat cgttggcagg agcagcggtt ttgtgcatgt cggcgacccg      1080
     gtggtcatca agttcgacac cttcccctat tcgcaatacg gcctcgccca tggaactgtg      1140
     cgggcactca gcccagattc cttctcggca caggagcaag cgcgcgatcc gaacagttcc      1200
     ttggccatgc tgccttccga cgccgagcca ttctatcgca cgcggatctc catcgaccag      1260
     gtcgccctcc acggcgtacc cgccggtttc gccgtcagcc ctggcatgcc ggtgaccgcc      1320
     gacgtaaagg tcggccgccg cacgatactc aagtacattc tcggcgtcat gctcccgatc      1380
     ggccaggagg caatgcggga gccttag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page