(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0590

BA000012.MLR0590     Location/Qualifiers
FT   CDS_pept        455176..456909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0590"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48149"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48149"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG4"
FT                   /protein_id="BAB48149.1"
FT                   /translation="MTILDRLTGLAFPAAVLRRAIKLADSGKAAEAFPLMAKAARAGIV
FT                   DAEYRVARCYLEGAGVPPSRMEGARWLLRAADHGSADAQALLAALYVTGLVTSEADGKG
FT                   PSEHLFKPDSAGKPDFTAAFDFATKAAEAGSATGQAILGYILTSGPASMRDADAAHRWY
FT                   EKSASAGCAEGCLGFALSLARRGKRENRVRIAEEVRRAADAGLPTATYLLAVLTEHGLG
FT                   VARDMAAAAQLYQAAAEKGLPSAQFRLGLALIDGALVGQDVAAGEAWMRRAALAGNIEA
FT                   AYLLGDRHAKTQRPDFAEAANWYRRAAEAGHQAAARALASLYLTGNGVAEDVEEGARWL
FT                   RSSASAGNQQAQTDLANLILGGAGEPDDGASVAGWFEAAASSGDLIAAFNLGLCFAKGV
FT                   GVRQDEGQAAHWLRRAAEGVAEAQYMYARLLQDGRGVAADPTQARVWFARAADAGVLDA
FT                   RVALAEMLLNGRGGMPEPEAAMQLFEQAAADGHAGAMFAIGALYGAGHGLPLDQTTAQK
FT                   WYAAAAGRGHSQAQFMLGRYLLKGLAGERDPVAARLWLERAAAHGISEAADELGAAGGS
FT                   D"
     atgacaatcc tggatcggct gactggtctg gccttcccgg cggcggtatt gcgtcgagcg        60
     atcaagcttg ctgacagcgg caaggccgct gaagcctttc cgcttatggc gaaagcggcc       120
     cgcgcgggga tcgtcgacgc cgagtaccgg gtcgcgcgtt gctatctgga aggcgccggt       180
     gtgccaccga gccgtatgga aggcgcgcga tggctgctgc gggcggccga ccacgggagc       240
     gcggatgcgc aagcgctcct cgccgcactc tacgtcaccg ggctggtgac gtcggaagcc       300
     gacggcaagg gaccctcgga gcacttattc aaacctgatt ccgctggaaa accagacttc       360
     acggccgctt tcgactttgc caccaaggcg gccgaggcag gctcggccac gggacaggcg       420
     atcctcggtt atatccttac cagcggcccc gcatcgatgc gcgatgccga tgcggcccac       480
     cggtggtacg agaagtcggc ttctgccggc tgcgccgaag ggtgccttgg ctttgccctg       540
     tcgctggctc gccgcggcaa acgcgaaaac agagttcgga ttgcggaaga ggtaagacgt       600
     gcagccgacg ccggcctgcc gaccgcgacc tatcttcttg cggtccttac cgagcacggg       660
     ctcggcgtag cacgcgacat ggcagcagcc gctcaactgt atcaggctgc tgcggagaag       720
     ggcctgccct ctgctcaatt ccggttggga ttggcactga tcgacggtgc actcgtcggc       780
     caagatgtcg ctgctgggga ggcgtggatg cggcgtgctg ccctggccgg caatatcgag       840
     gcagcctatc tcctgggcga tcgccatgcg aagacgcagc ggccggattt tgcggaagcc       900
     gcgaactggt atcggcgggc agccgaagcg ggccaccaag ccgccgcccg cgctttggcc       960
     tcgctctatt tgactggaaa tggtgtggct gaggatgtcg aggaaggagc acgctggctg      1020
     cgctcttccg caagtgccgg caatcagcag gcacagacag acctcgccaa tcttatcctc      1080
     ggaggggctg gcgagccgga cgacggtgca agcgttgccg gatggttcga ggcggccgca      1140
     tcatcgggcg acctcatcgc ggcattcaac cttgggctct gcttcgccaa gggcgtcggc      1200
     gttcgccagg acgaggggca agcggcacac tggctgcggc gcgcggccga aggcgtcgcc      1260
     gaggcacaat atatgtatgc ccgcctcctc caggatggac gcggcgtggc ggccgaccca      1320
     actcaggccc gcgtgtggtt tgcgcgggcg gccgacgccg gcgtgctcga cgcacgcgtg      1380
     gcgctcgccg agatgctact caatgggcgc ggcggcatgc ccgagcccga ggctgcaatg      1440
     cagttgtttg aacaggccgc cgccgacggt cacgccgggg cgatgtttgc gattggcgcg      1500
     ctgtacggag ccggccacgg cctgccgctc gaccagacaa cggcacagaa atggtacgct      1560
     gccgctgccg gacgtgggca tagccaagcc caattcatgc tcggacgtta tctcttgaaa      1620
     ggcctcgccg gggagcgcga cccggttgcc gctcgccttt ggctcgaacg tgcggctgcg      1680
     cacgggatca gtgaagccgc cgacgaactg ggggctgcgg gcgggtccga ctag            1734
//

If you have problems or comments...

PBIL Back to PBIL home page