(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0593

BA000012.MLR0593     Location/Qualifiers
FT   CDS_pept        460191..460742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0593"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48151"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48151"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG2"
FT                   /protein_id="BAB48151.1"
FT                   /translation="MVVGFLQIGKSATRQSWTDPRTSMSLVPERACYLTGQGLYQVGTA
FT                   WFGSRWKRALSIYGAATMNDPSAGKPAYDPQQLEPMLIARQHAGDVDGMVALFEADAVI
FT                   DCGDGRFLRGREAIRDYYAEIVTSGRKFAVGEQRPALVCGDLALTSTRLPDGDVTSEVA
FT                   RRQADGSWLWVIDRYSVAWD"
     atggtggttg gttttttaca aattggcaag agcgcaactc gacaaagctg gacagatccc        60
     agaacgtcca tgtcactcgt cccggaacgc gcgtgctatc tgacgggcca ggggctttac       120
     caggttggga cagcatggtt cggcagccgg tggaaaaggg cgctaagtat ttatggagct       180
     gccaccatga acgatccgag cgcgggaaag cccgcttacg acccgcagca gctggagccc       240
     atgctgatag cgagacagca tgctggcgat gtcgatggca tggtcgcgct gttcgaggcg       300
     gatgcggtga tcgactgcgg cgacggacgc tttctgcgcg gccgcgaagc cattcgtgac       360
     tactatgccg agatcgttac gtccggacgg aagtttgcgg tcggagagca gcgaccggcg       420
     ctcgtttgcg gcgaccttgc cctcacttcg acccgacttc ccgacggtga tgtgaccagc       480
     gaggttgccc ggcggcaggc cgacggctcc tggctctggg tgatcgatcg ctattccgtt       540
     gcttgggatt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page