(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0625

BA000012.MLR0625     Location/Qualifiers
FT   CDS_pept        490823..491602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0625"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48180"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48180"
FT                   /db_xref="GOA:Q98MD3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD3"
FT                   /protein_id="BAB48180.1"
FT                   /translation="MAMQDQNNSTKTEAAYQLLRRDILTTRLMPGAPLKLSALRGTYGV
FT                   GWTPLREALSRLEAERLVTAISNRGFAVAPVSRAELEDLARARMVVEMPLFLESIANGG
FT                   REWEDAVVTAHYRLSRCKTAVEDPSDAAVDKWDESHEAFHAALLSAATSNWLLRFRSTI
FT                   ADQLRRHHRFLGLAPTLRAAAGLKDGYGEAMDALREAIAIEHHTEIMEAALDRDVERAK
FT                   ALMTAHIGYTLHVYVHSEDNCANPYTARAGSLKAVSG"
     atggcgatgc aggatcagaa caattccacg aagaccgagg cggcctatca gctgctgcgg        60
     cgcgatatcc tgaccacccg cctcatgccg ggcgcgccgc tcaagctgag cgcgctgcgc       120
     ggcacatacg gcgtcggctg gacgccgctg cgtgaagcct tgtcccgact tgaagccgaa       180
     cgcctggtca ccgccatcag caatcgcggc tttgccgtcg ctcccgtgtc gcgcgccgag       240
     ctcgaggacc tggcgcgcgc aaggatggtt gtcgaaatgc cgctgttcct ggaatcgatc       300
     gcgaacggcg gcagggaatg ggaggacgcg gtcgtcaccg ctcattaccg gctctcccgc       360
     tgcaagaccg cggtcgaaga cccttccgat gcggccgtcg acaaatggga cgagagccac       420
     gaggccttcc atgcggcgtt gctgagcgcg gcgacgtcga actggctgtt gcgcttccgc       480
     tcgacgatcg ccgatcagct gcggcggcat caccgttttc tcggcctggc gcccacatta       540
     cgagcggcgg ccggcctcaa ggacggctat ggcgaggcaa tggacgcttt gcgcgaggcg       600
     atcgccatcg agcatcacac cgagatcatg gaagcggcgc tcgatcgcga cgtcgagcgg       660
     gcaaaggcgc tgatgacggc gcatatcggc tacacgctgc acgtctatgt gcacagcgaa       720
     gacaattgcg ccaatcccta caccgcgcgc gccggcagtc tgaaagcggt ttccggatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page