(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0658

BA000012.MLR0658     Location/Qualifiers
FT   CDS_pept        516323..516787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0658"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48205"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48205"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA8"
FT                   /protein_id="BAB48205.1"
FT                   /translation="MSETIEKRLSDLGVTLPVAAAPAANYVPYCRSGNLLFTAGQLPLK
FT                   DGKLQASGLLGRDVDTASGKEAAKYCAINILAQARAALGDLEKISRLVKITVFVASAPD
FT                   FVEQHLVANGASDFLVAALGERGKHARSAVGTTSLPLNAAVEIEAIFEVE"
     atgagtgaaa caatcgaaaa gcggctaagc gatctcggcg tgacgcttcc tgtcgcggcc        60
     gcacctgccg ccaactacgt tccctactgc aggtcgggca atctgctgtt caccgccggg       120
     caattgccgc tcaaggacgg caagctgcag gcgagcggtc tgctcggccg cgacgtcgac       180
     acggcaagcg gcaaagaggc ggcgaaatac tgcgcgatca atattctggc gcaagccagg       240
     gctgcgctcg gcgacctgga gaaaatcagc cggctggtca agatcactgt cttcgttgcc       300
     tccgcccccg actttgtcga gcagcatctg gttgccaatg gtgcctccga tttcctggtc       360
     gccgcccttg gcgagcgcgg caaacacgct cgctccgccg tcggcaccac ctctctgccg       420
     cttaatgccg cggtggaaat cgaagccatc ttcgaagtcg aatga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page