(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0698

BA000012.MLR0698     Location/Qualifiers
FT   CDS_pept        551210..552037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0698"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48238"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48238"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M75"
FT                   /protein_id="BAB48238.1"
FT                   /translation="MQLKNTDICQSLDWSRCLPEKLQHVLILAHPGHELRIHHWIELSK
FT                   PRIYLLTDGSGGRHSARTQYSRDLVEAAGATAGAVFGDMPDAVWYKALLAGDSGFFADV
FT                   LARIHADLSDMQDVQIVSDAVDGYNPMHDLAYAFGDAINRLLQRPARKQLCSAAVPNVP
FT                   GAVEVEIQLDSAARARKMAAVKAYTPLADEARQILDRDPQCFDRELLISQHFDWDAPWT
FT                   PDWERIGKERVANKVYDRCITYKENVQPVAQRLMSEGDRTHAPRKVQRLPSRA"
     atgcaattga aaaacacaga tatatgccaa agcctggatt ggagccgttg tttgcccgaa        60
     aaattacaac atgtgctgat ccttgcgcat ccagggcatg agcttaggat tcatcattgg       120
     attgagctga gcaaaccgcg aatctacctt ttgacggatg gttcgggcgg acgccattct       180
     gccagaaccc aatattcacg cgacctcgtg gaagctgccg gtgcaaccgc cggcgcggtg       240
     ttcggcgata tgcctgatgc cgtctggtac aaggcgctgt tggctggaga cagcggcttc       300
     tttgccgatg tgctggcgag gatccatgcc gatctgtctg atatgcagga cgtgcagatc       360
     gtctcggacg ccgtcgatgg ctacaatccg atgcacgatc tggcctatgc attcggcgat       420
     gccatcaacc ggctgctgca aaggccggct cgcaagcagc tttgttccgc cgcggttccc       480
     aacgtgccag gggctgtcga ggtggaaatc caactggatt cggctgcgcg cgccagaaag       540
     atggctgcgg tcaaagccta cacgccattg gcggatgaag cccgccagat tctggatcgg       600
     gacccgcagt gcttcgaccg ggaacttctc atctcgcagc actttgactg ggatgcgccg       660
     tggacgccgg actgggagcg catcggcaaa gagcgggtgg cgaacaaagt ctacgacaga       720
     tgcatcacct acaaggaaaa tgtacagccg gtcgcgcagc gactgatgtc ggaaggcgac       780
     cgaactcacg cgccgcggaa agtccagcgt ctgccttccc gggcctag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page