(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0735

BA000012.MLR0735     Location/Qualifiers
FT   CDS_pept        579716..580339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0735"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48266"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48266"
FT                   /db_xref="InterPro:IPR014956"
FT                   /db_xref="InterPro:IPR016932"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M47"
FT                   /protein_id="BAB48266.1"
FT                   /translation="MIDPREPIVTPVPVEELRPTQITVGMREVALKRQMIREQDAKKKT
FT                   GAFLGKHMVPVVLGPKNRNYVTDHHHLARALLEEGVKDVLVTVISDLSALDKDTFLFVL
FT                   DNRGWMHPFDESGRRRDYSAIPKTIGELIDDPYRSMAGELRRMGGFAKDTTPFSEFIWA
FT                   DFLRRRIDRNAVAKNFDKAMKEALSLAKGKDADYLPGWCGPTSD"
     atgatcgacc cgcgagaacc cattgtcacg ccggttcccg tcgaggaatt gaggccgacg        60
     cagataacgg tcggcatgcg ggaagttgca ttgaagcgcc agatgatccg ggagcaggac       120
     gccaagaaga agaccggcgc ttttctcggc aaacacatgg tgccggtcgt attgggtccc       180
     aagaatcgca actacgtcac cgatcaccat cacctcgccc gcgccctgct cgaggaaggt       240
     gtcaaggacg tgctggtgac cgtgatcagc gacctgtccg cgctcgacaa ggacacgttt       300
     cttttcgtgc tcgataacag aggctggatg cacccgttcg atgagagcgg ccggcgccgc       360
     gattactcgg caatcccgaa gacaatcggc gagctgatcg atgatcctta ccggagcatg       420
     gcgggcgaac tgcgccggat gggcggcttt gccaaggaca cgacgccgtt cagcgaattc       480
     atctgggcgg atttccttcg tcggcgcatc gatcgcaacg cggttgcgaa gaacttcgac       540
     aaggcgatga aagaggcact cagcctagcc aagggcaagg acgcggacta tctgccgggc       600
     tggtgcggcc cgacctcgga ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page