(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0746

BA000012.MLR0746     Location/Qualifiers
FT   CDS_pept        585751..586245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0746"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48274"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48274"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M39"
FT                   /protein_id="BAB48274.1"
FT                   /translation="MKDLGSMNAKTQGDAAPEALEFEYDLAEPPEKVWRALTVPELLAA
FT                   WMMPNDIRPEIGNRFAFAGTEAAIECEILDAEPERLLRYSWRQQPGDAARQDPLDSVVT
FT                   FTLARTVSGGTHLRIVHDGFGGKAMPAVAMASGGCRLSLGLHGRAKPVAANIPNTLLLA
FT                   A"
     atgaaggatt tgggatcgat gaacgccaaa acccagggcg acgccgcccc ggaggcgctg        60
     gagttcgaat acgaccttgc cgagccgccg gaaaaagtgt ggcgggcgct gaccgtgccg       120
     gaactgctcg ccgcctggat gatgccgaac gacatcaggc cggaaatcgg caatcgtttt       180
     gccttcgccg ggactgaagc tgccatcgaa tgcgaaatcc tcgacgccga gccggagcgt       240
     ctgctgcgct attcttggcg gcagcagccg ggcgacgccg cgcgccagga tccactcgac       300
     agtgtcgtca ccttcacact cgcccgcacc gtttccggcg gcacgcatct gcgcatcgtc       360
     catgacggtt ttggtgggaa agcaatgccc gccgtcgcca tggctagcgg cggctgccgg       420
     ctttcgcttg gattgcacgg gcgcgcaaag cctgtcgccg cgaacatacc gaacaccttg       480
     ctgctcgcag cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page