(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0752

BA000012.MLR0752     Location/Qualifiers
FT   CDS_pept        591443..592249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0752"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48279"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48279"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M34"
FT                   /protein_id="BAB48279.1"
FT                   /translation="MSKSGTIRSGMGGWTFEPWDTSFYPDKLSKAKQLQYASRQVPSIE
FT                   VNGTYYSSFKEPTFVKWASEAPDGFVYSLKGNRFVTNRRVLGEAGESMMRFLGSGVAAL
FT                   GDKLGPILWQFAPTKKFDPDDFEAFLKLLPEKQDGVALRHALEVRNDSFFVPEFAALAR
FT                   KYKAAIVYADHAKYPDIADVTGDFVYARLQTGSDDNPDCYTPKGLDEWAARAKIWAEGK
FT                   QPADLRRADPATDAPVQPRDVFVYFITEGKVRAPFGAMALMKRIAG"
     atgagcaaat cgggaacaat ccgctccggc atgggcggct ggacctttga gccctgggat        60
     acgtccttct atccggataa gttgtcgaag gccaagcagc tgcaatatgc cagccggcag       120
     gtgccgagca tcgaggtcaa cggtacctac tattccagct tcaaggagcc gaccttcgtc       180
     aaatgggcaa gcgaggcgcc ggacgggttt gtctattcgc ttaagggcaa ccgcttcgtc       240
     accaatcgcc gcgtgctggg cgaggccggt gaatcgatga tgcgcttcct cggttccggc       300
     gttgccgcgc tcggcgacaa gctcggcccg atcctgtggc agttcgcgcc gacgaaaaag       360
     ttcgatccgg acgatttcga agcttttttg aaactgctgc cggagaaaca ggatggtgtc       420
     gcactgcgtc acgcgctcga agtccgcaac gacagtttct tcgtgccgga attcgcggcg       480
     cttgcccgta aatacaaggc ggcgatcgtc tatgccgacc atgccaaata tcctgacatc       540
     gccgacgtca ccggtgactt cgtctacgca cggctgcaga ccggctcgga cgacaacccc       600
     gattgctaca cgcccaaggg gctcgacgag tgggcggcac gggcaaaaat atgggcggaa       660
     ggcaagcagc cggccgattt gcggcgcgcc gatcccgcca ccgacgcgcc cgtgcagccg       720
     cgcgatgtgt tcgtctactt catcaccgag ggcaaggtgc gcgcgccgtt cggggcgatg       780
     gcgctgatga agcgcatagc cggctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page