(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0754

BA000012.MLR0754     Location/Qualifiers
FT   CDS_pept        592298..593584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0754"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48280"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48280"
FT                   /db_xref="GOA:Q98M33"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M33"
FT                   /protein_id="BAB48280.1"
FT                   /translation="MRFARSKTPIPGHLRRDRNFIDTSLLHECGDGKPHSWSRRRQGKR
FT                   GMSLDYTSLLLAVGFSAACLSLTLFGMWLTARTERFLLTWAISLVFVVGDIFVYDAYID
FT                   MPGRLLGIATLALLLLGFSTMLGAAFQFRTGGSPLPLALLGCVSLAVTLPPMALGYDGL
FT                   GFMFENLFAALLLFATAFEYWRGRDEAPALTIGITTLYSATAVSFMLCAAVLAWDGRLV
FT                   LGHAPSNWAEELSLIVVIASMTGIGALSLALNQGRLARHHRRNALTDPLTGLLNRRALF
FT                   DMHGHVPVGAFTAVVVFDLDNFKAINDEFGHAAGDEVLKVFARELAGNLRQTDIAARMG
FT                   GEEFALVLKRTLPETVEDAAERIRTAFATRLIETETGSLRCTVSAGFAFGSKEGLSFDK
FT                   VLSAADKALYDAKRGGRNRVTASPFRRAS"
     atgcgttttg cgcgtagcaa aacgcctatt cctgggcatc ttcgccgcga tcgtaacttt        60
     atcgacactt ccttgctgca tgaatgcggc gacggcaagc cgcacagctg gagccgccgc       120
     cggcagggaa agaggggcat gtcgctcgac tacacttcac ttctgctggc cgtcggtttc       180
     tccgccgctt gcctgagcct gacattgttc ggcatgtggc tgaccgcccg cacggaacgg       240
     tttctgctga catgggcgat cagcctggtg ttcgtggtcg gcgatatctt tgtctacgac       300
     gcctatatcg acatgcccgg acgcttgctc ggcatcgcca cccttgccct gttgctgctc       360
     ggcttctcca ccatgctggg tgcggccttc cagttcagaa ccggcggctc gccgctgccg       420
     ctcgcactgt tgggctgtgt ttcactggcg gtgacgctgc cacccatggc tctgggctac       480
     gatggcctcg gcttcatgtt cgagaacctg ttcgctgcct tgctcctgtt cgcgacggca       540
     ttcgaatact ggcgaggccg cgacgaggcc cctgccctga cgatcggcat caccacgctc       600
     tattcggcca ccgccgtttc cttcatgctg tgcgcggcgg tcctggcatg ggacggcagg       660
     ctggttctcg gccatgcacc aagcaactgg gccgaggaac tgagcctcat tgtcgtcatc       720
     gccagcatga cgggtattgg tgccctgtcg cttgcgctca accaggggcg tctggcgagg       780
     catcatcgcc gcaatgcgct caccgatccc ttgaccggcc tgctcaaccg gcgcgcgctt       840
     ttcgacatgc atggccacgt cccggtcggt gcctttaccg ctgtggtcgt cttcgacctc       900
     gacaatttca aagccatcaa cgacgagttc ggccacgcgg ccggtgacga ggtgctgaag       960
     gtgtttgcga gggaactcgc cggcaatctt cgccagaccg acatcgccgc gcgcatgggc      1020
     ggcgaggaat tcgcactggt gctgaagcgc acgctgccgg aaacggtcga ggacgcggca      1080
     gagcgcatcc ggaccgcctt cgcgacacgc ctgatagaga ccgaaaccgg ctcgctgagg      1140
     tgcacggtca gcgccgggtt tgcatttggc agcaaagagg gcctcagctt cgacaaggtg      1200
     ctcagcgccg ccgacaaggc gctctacgac gccaagcgcg gcggccgcaa ccgcgtcacc      1260
     gcctctccat tccggcgcgc gagctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page