(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0769

BA000012.MLR0769     Location/Qualifiers
FT   CDS_pept        606394..607143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0769"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48291"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48291"
FT                   /db_xref="GOA:Q98M22"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M22"
FT                   /protein_id="BAB48291.1"
FT                   /translation="MQWLDSVAGPGYAAALLWTFAALILLVIVLVIIRLVRNLTFGTFV
FT                   AGGRNRKTRLAVMDATAVDSHRRLVLVRRDDIEHLLLIGGPTDVVVERDIRLAAPRRPA
FT                   LTGDGGLQPVPATAAPTAKPRPPQPAPAPARPAPQPVTAAPPPARPRPAAPPPAPAPAP
FT                   KPVAQPYQSTNVTPLPAYGSANANAVRQAPPPPQDSIDDALMKDLEVSLDQPRSGGPVG
FT                   KPATKPPQSLDDEMTRLLGELSSSQKR"
     atgcagtggc tggatagcgt ggcgggccct ggttatgcgg cggcactcct gtggaccttc        60
     gcggcgctga tcctgctggt catcgtgctc gtcatcatca ggctcgtgcg caacctgacc       120
     ttcggtacgt ttgtcgccgg tggccggaac cgcaagacgc ggctggccgt catggacgcc       180
     accgccgtcg acagccatcg ccggctggtg ctggtgcgcc gcgacgacat cgaacatctg       240
     cttctgatcg gcggcccgac cgacgtcgtc gtcgaacgcg acatacgcct tgccgcaccg       300
     cgccgtccgg cgctgaccgg agatggcggt ctgcagcctg tcccggccac cgcggccccg       360
     acggcaaaac cgcggccgcc tcagccggcg cccgcaccag cccgacctgc gccgcagccg       420
     gtgaccgcgg cgccgccgcc tgcccgcccg cgcccggcgg cgccaccgcc ggccccagcc       480
     cccgcaccga aaccggttgc gcaaccctat caatcgacaa acgtcacgcc gctgcctgct       540
     tatggctccg ccaacgccaa tgccgtcagg caggcgccac cgcccccgca agacagcatc       600
     gacgacgcgc tgatgaagga cctggaggtt tcgctcgacc agccgcgctc cggcggccct       660
     gtcggcaaac cggcgaccaa gccgccgcaa tcgctcgacg atgaaatgac caggcttctg       720
     ggcgaacttt cttcaagtca gaaaagatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page