(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0776

BA000012.MLR0776     Location/Qualifiers
FT   CDS_pept        610039..611124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0776"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48295"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48295"
FT                   /db_xref="GOA:Q98M18"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M18"
FT                   /protein_id="BAB48295.1"
FT                   /translation="MTAPRKPAAFRIEPEAAPTQETPKARQAELSRKPRGLKTDVALVI
FT                   PAEVDVFDEPDIVAAEPPPAAAPRKRSLFGSIFFGAIGVLVSLAVGLWTDQLIRDLFAR
FT                   AEWLGWLAAGMAAIAVLALVVILIREFLAIARLAEVEKLQKRALDAIARDDPKAARSVV
FT                   DELSAFVAAKPETAAGRRALAELRGEIIDGGNLVRLAEAEILGPLDARAKVMILEAAKR
FT                   VSLVTAVSPRALVDVAYVVFEAGRLIRRLSELYGGRPGTLGFFRLARSVLAHLAVTGSI
FT                   AVGDSFVQQIVGHGLAARLSAKLGEGVVNGMMTARIGIAAMETARPLPFSAAKRPGLGD
FT                   FLSALTSFAAKKDTETTGSGK"
     atgaccgcgc cccgcaaacc ggcggccttc cgcatcgagc cggaagccgc gccaacacaa        60
     gagacgccaa aggcgcgcca ggccgagctc tcgcgcaaac ctcgcgggct gaagaccgat       120
     gtcgctctgg tcataccggc ggaagtcgac gtcttcgacg aacccgacat cgtggccgcg       180
     gaaccgccgc cggcggccgc ccccaggaaa cgctcgctgt tcggcagcat cttcttcggc       240
     gcgatcggcg tgctggtttc gctggctgtc ggcctgtgga ccgaccagct gatccgcgat       300
     ctcttcgccc gagccgaatg gctgggctgg ctggccgccg gcatggcggc gatcgccgta       360
     ttggcgcttg tggtgatcct gattcgggaa ttcctggcga tcgcccgcct tgccgaagtc       420
     gaaaaactgc aaaaacgcgc gctcgacgcc atcgcgcgcg acgatcccaa ggcggcacga       480
     tcggtggtcg acgagctttc ggctttcgtc gcggccaagc cagagaccgc ggcgggtcgg       540
     cgtgccctgg ccgaactgcg cggcgaaatc atcgacggcg gcaatctggt gcgcctggct       600
     gaagcggaaa tcctcggtcc cctcgatgcc agggccaagg tgatgattct cgaagccgcc       660
     aaacgcgtct cgctggtgac ggctgtcagc ccgcgcgcgc tggtcgacgt cgcctatgtc       720
     gtattcgagg ccggacgcct cattcgccgt ctctcggaac tctatggcgg acgcccggga       780
     acgctgggtt tcttccgcct ggcgcgcagc gtgctggcgc atctggcagt caccggctcc       840
     atcgccgtcg gcgacagttt cgtccagcag atcgtcggcc acggcctggc ggcgcgccta       900
     tcggctaagc ttggcgaagg cgtcgtcaac ggcatgatga cggcgcgcat cggcatcgcg       960
     gcgatggaaa ccgcgcgtcc cctgcccttc agcgccgcca aacggccggg cctgggcgat      1020
     ttcctctcgg cattgacatc gtttgccgcg aagaaggaca ccgaaaccac aggctctggc      1080
     aaatag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page