(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0783

BA000012.MLR0783     Location/Qualifiers
FT   CDS_pept        614761..616596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0783"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48300"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48300"
FT                   /db_xref="GOA:Q98M13"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M13"
FT                   /protein_id="BAB48300.1"
FT                   /translation="MAAETSGSDLIQVVALLAAGVVAVPIFKRMGLGSILGYLAAGVVI
FT                   GPFGLRIFSESGAILHVAELGVVMFLFIIGLEMQPSRLWGLRREIFGLGALQVGVCAVL
FT                   LTGVGMAGGFPVSQSFVAGAGFVLTSTAIVMQLLEERGEIASPKGQRIVSILLLEDLAI
FT                   VPLLALIAFLAPGGADTSMSERLTEVGIGLAAIVGLVLAGRYLLNPFFRILADARAREV
FT                   MTAAALLVVLGSALAMQLSGLSMAMGAFLAGVLLSESTFRHQLEADIEPFRGILLGLFF
FT                   LAVGMSLDLHVVAANWRLIAVYVVAYMVMKALGIYIVARILKTGHREALERAVFMAQGG
FT                   EFAFVLYSAAAAVGIIDNQANATLTAIVIISMVLTPLAIIALRYVTPRDEQSLDGVDVA
FT                   DGLTGSVLIIGFGRFGQIASQPLLLRGIDVSIIDNDVEMIQAAADFGFKVYYGDGTRLD
FT                   ILHAAGAGRARAVLICVDKADAAVRIVQLIKAEFPLLTVLARAFDRGTALQLIRAGVDY
FT                   QLRETFESALVFGGSALESLGVDPEDVAETIEDVRRRDTERFETQLAEGIRAGQRFLRG
FT                   NIGTPIPTPLSTPRRPGQALNEETAGVLHKSETAD"
     atggcagcgg aaacatcagg cagcgatctc attcaggtgg tggcgctgct tgccgctggg        60
     gtcgtcgccg tccccatctt caagcgcatg ggcctcggct cgatcctggg ctatctggcc       120
     gccggcgtgg tgatcggccc gtttggcctt cgcatctttt ccgaatcggg agccatcctc       180
     cacgtcgccg agctcggcgt cgtcatgttc ctgttcatca tcgggctgga aatgcagccg       240
     tcgcggcttt ggggcctacg ccgcgaaatc ttcgggctcg gtgcgctgca ggtcggggtc       300
     tgcgcggttc tgttgaccgg cgtgggaatg gccggcggtt ttccagtctc gcaatccttt       360
     gtcgccgggg ccggtttcgt gctgacctcg acggcgatcg tcatgcagct tctcgaggaa       420
     cgtggcgaaa tcgcctcgcc gaaaggccag cgcatcgtct ccatcttgct gctggaagat       480
     ctggccatcg tgccgctgct ggccctgatc gcgttcctgg cgcccggtgg tgccgacacc       540
     agcatgtcgg agcggttgac cgaggtcggc atcggccttg ccgcgatcgt cgggctggtg       600
     ctggcgggcc gctatctgct caaccccttc ttccgcatcc tggcggatgc ccgagcccgc       660
     gaggtgatga cggccgcggc attgctggtc gtgctcggat cggcgctcgc catgcagctc       720
     agcgggctgt cgatggcgat gggcgcgttc ctggccggcg tgcttctgtc cgaatcgacc       780
     ttccgccatc agctggaagc cgacatcgag ccgttccgcg gcatcttgct cggcctgttc       840
     ttcctggcgg tcggcatgtc gctcgacctg catgtggtgg ccgcgaactg gaggctgatc       900
     gctgtctatg tcgtcgccta catggtcatg aaggctcttg gcatctacat cgtcgcccgc       960
     atcctcaaga ccggccatcg cgaagcgctg gaacgcgccg tcttcatggc gcagggcggc      1020
     gaattcgcct tcgtcctcta ctccgctgcc gctgccgtcg gcatcatcga caaccaggcc      1080
     aacgcgacgc tgacggcgat cgtcatcatt tccatggtgc tgacgccact ggcgatcatc      1140
     gccttgcgct atgtcacccc gcgcgacgag cagtcgctcg acggggtcga tgtcgccgac      1200
     ggcctgaccg gcagcgtgtt gatcatcggt ttcggccgct tcggccagat cgccagccaa      1260
     ccactgctgc tgcgcggcat cgatgtgtcg atcatcgaca atgatgtcga gatgatccag      1320
     gcggcggccg atttcggctt caaggtctat tatggtgatg gcacgcggct ggatatcctg      1380
     cacgcggccg gagccggccg ggcgcgcgcc gtgctgatct gcgtcgacaa ggccgatgcg      1440
     gccgtccgta ttgtccagtt gatcaaggcg gaatttccgc tgctcaccgt gctggcccgg      1500
     gctttcgacc gcggcacggc gctgcagctc atccgcgccg gcgtcgacta tcagttgcgc      1560
     gagactttcg aatcggcact ggttttcggc ggctcggccc tggaatcgct cggcgttgat      1620
     cccgaagatg tggccgagac gatcgaggac gtcaggcgcc gcgacaccga acgtttcgaa      1680
     acccagctcg cggaaggcat tcgcgcaggc cagcgcttcc tgcggggcaa tatcggcacg      1740
     ccgattccga caccgctctc cacgccgcgc cgtcctggtc aggccctcaa cgaggagacg      1800
     gccggcgttc tgcacaaatc cgaaacagcc gactga                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page