(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0784

BA000012.MLR0784     Location/Qualifiers
FT   CDS_pept        616612..617157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0784"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48301"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48301"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M12"
FT                   /protein_id="BAB48301.1"
FT                   /translation="MELDSGALSVTKFWRDAGEDAWFEKNDAFDGDFRDRFLDLHYAAA
FT                   RRECDAWSNHAEGSLALMILLDQFPRNCFRGTGHMYATDPLAKHFAEKAVAAGHDLALE
FT                   PELRVFLYLPFEHAENLADQDISVELHTARAEFNLKYALEHRDIIKRFGRFPHRNRMLG
FT                   RETTPQEQAFLDEGGFSG"
     atggaactgg acagcggagc cctgtcggtc accaaattct ggcgcgacgc cggcgaggat        60
     gcatggttcg agaagaacga cgctttcgat ggcgattttc gcgaccgctt tctcgacctg       120
     cactatgccg ccgcgcggcg tgaatgcgat gcctggtcga accatgccga aggttcgctg       180
     gcgctgatga tcctgctcga ccagtttccg cgcaattgct tccgcggcac cggccatatg       240
     tatgccaccg atccgttggc gaagcatttc gctgaaaagg cggtcgctgc cgggcatgat       300
     ctggcgctgg aaccggaact ccgcgtgttc ctgtatttgc cgttcgaaca tgccgaaaac       360
     cttgccgacc aggacatttc ggtcgaactg cacaccgcca gggccgagtt caacctgaaa       420
     tacgcgctgg agcatcgcga catcatcaag cgcttcggcc ggtttccgca tcgcaacagg       480
     atgcttggcc gcgagacgac accgcaagag caggcgtttc tcgacgaagg tgggttttcg       540
     ggctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page