(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0791

BA000012.MLR0791     Location/Qualifiers
FT   CDS_pept        619811..621304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0791"
FT                   /product="probable membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48306"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48306"
FT                   /db_xref="GOA:Q98M07"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M07"
FT                   /protein_id="BAB48306.1"
FT                   /translation="MDKIMDQAVDKQTMAAAATPLTESEKNAIIGGVLLSMLLAALDQT
FT                   IIAPAMPTIARALGHAEYLPWMVTGYLLTATAVAPLYGKISDVYGRRPTIYAAILIFLV
FT                   GSLVSAMAPNMFVLVIGRAIQGAGGGGLFALAQTVIGDLVPPRERARYAAWVSGTWAVA
FT                   SIAGPLLGGTFAEHLHWSLIFWINIPLGLLAMAIINKPLKKLPIAAKHHRIDGLGALLL
FT                   VIATALLLLALNWGGSTYAWFSREIVGLVAGSAVFWALFAIRLMGATEPLISLEVLGNP
FT                   IVLAGALSMFLLQAANIGASVYLPVYLQTVIGLSVSESGMAMLGLLLGTVAGAATSGRL
FT                   IPRFVHYKRIAMIGITLAIVSIGLLSAIAGHASLLEVEILTTLIGLGSGTTFPVATVSV
FT                   QNAVDRTHLGVATGVLTFLRTLGGALGVALLGAVAIGYGLPLSAEGSQTHIQLTSALPF
FT                   VMIFITAGITLVLALVAMMLMPEKALRGRDEVAAPVLAE"
     atggacaaga tcatggacca ggctgtcgac aagcagacca tggcggctgc cgccacgccg        60
     ctgaccgaaa gcgagaagaa cgccatcatc ggcggcgttc ttctgtcgat gctgttggcg       120
     gcgcttgacc agaccatcat cgcacccgca atgccgacca tcgcgcgggc gctcggccac       180
     gccgagtatc tgccctggat ggtcaccggc tatctcctga ccgcgaccgc cgtggcgccg       240
     ctctacggca agatttccga cgtctatggc cgccgcccga ccatttacgc ggcgatcctc       300
     atcttcctcg tcggatcgct ggtcagcgcc atggccccca acatgttcgt gctggtgata       360
     gggcgcgcga tccagggtgc cggcggcggc ggcctgtttg cgctggcgca aaccgtgatc       420
     ggcgacctcg tgccgccgcg cgaacgcgca cgttacgcgg cctgggtctc gggcacctgg       480
     gccgtcgcca gtattgccgg gccactgctg ggcggcacct ttgccgagca cctgcactgg       540
     tcgctgatct tctggatcaa cattccgctt gggcttttgg ccatggcgat catcaacaag       600
     ccgctgaaga agctgccgat cgcggccaaa catcaccgca tcgacgggtt gggcgccctg       660
     cttctggtta tcgccacggc acttctgctt ctggcgctca actggggcgg gagcacctat       720
     gcgtggtttt cgcgcgaaat tgtcgggctc gtggccggtt cggccgtgtt ctgggccctg       780
     ttcgcaataa ggctgatggg ggcgaccgag ccgttgatct cgctcgaagt gctgggcaac       840
     ccgatcgtgc tcgccggtgc gctatcgatg ttcctgctgc aggcggcgaa tatcggcgct       900
     tcggtctacc tgccggtcta tctgcaaacc gtgatcgggc tttccgtcag cgaatcggga       960
     atggccatgc tcggcctttt gctcggcacg gtcgccggtg ctgctacaag cggccgcctg      1020
     atccctcgct tcgtgcacta caagcgcatc gccatgatcg gcatcacctt ggccattgtc      1080
     agcatcggct tgctcagtgc cattgccgga cacgcctcgc tgctcgaggt cgagatcctg      1140
     accaccctga tcggcctggg cagcggaacg acattcccgg tcgcgaccgt ctccgtccag      1200
     aacgccgtcg atcgaactca tctcggggtt gcgaccggcg tgctgacctt cctgcgtacg      1260
     ctgggtggcg cgctgggcgt cgccctgctc ggcgcggtcg cgatcggcta tggcctgccg      1320
     ctctccgccg agggctcgca gacacatatc cagctgacct cagccctgcc gttcgtaatg      1380
     atcttcatca ccgccggcat caccctggtg ctggcgcttg tcgccatgat gctgatgccg      1440
     gaaaaggcgc tgcgcggacg cgacgaggtg gccgcgcccg tcctcgcgga atag            1494
//

If you have problems or comments...

PBIL Back to PBIL home page