(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0794

BA000012.MLR0794     Location/Qualifiers
FT   CDS_pept        622716..623192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0794"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48309"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48309"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M04"
FT                   /protein_id="BAB48309.1"
FT                   /translation="MPSWAMKVSLVICHLKGVSAEIITPADKSTAARKRRSVTFFQKTG
FT                   SAIDGGDEIAHFVDQFAEPIEGLAVFRLPLDLGGTIGDGKGADAASGPLQPMRQQKPVL
FT                   EIGIDYFVAYRQRLLYKQRQHLLLEGAVAHRLPGKVCQIDRSGLPGSRDVASGH"
     gtgccgtcat gggcgatgaa ggtcagcttg gtcatttgtc acctgaaggg agtttccgcc        60
     gagataatca ctccggcaga caagtcaact gccgcgcgaa agcgccgctc ggtgacgttt       120
     ttccaaaaaa ccgggtcagc gattgatggc ggcgatgaaa tcgcgcactt cgtcgatcag       180
     tttgccgagc cgattgaggg tctggccgtc ttccggctgc cgctcgatct cggtggcaca       240
     atcggcgatg gcaaaggcgc cgacgccgcg agcggacccc ttcaacccat gcgccagcag       300
     aagccggtcc ttgagatcgg catcgactat tttgtcgcgt accgacagcg cctgctgtac       360
     aaacagcgcc agcacctctt gctcgagggc gcggtcgccc atcgtctgcc gggcaaggtg       420
     tgccaaatcg accggtcggg actgcctggt tcccgagacg tcgcctccgg gcattga          477
//

If you have problems or comments...

PBIL Back to PBIL home page