(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0842

BA000012.MLR0842     Location/Qualifiers
FT   CDS_pept        673813..674265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0842"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48345"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48345"
FT                   /db_xref="GOA:Q98LW8"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW8"
FT                   /protein_id="BAB48345.1"
FT                   /translation="MPKELGIQEQVFGGEHHTGRVARPLWTAMKRGLLGRCPNCGEGKL
FT                   FRGFTKTVDTCSVCGEEIHHHRADDLPAYLVIVIVGHIVLGAFMGVEATSTLSTWQHIL
FT                   IWVPLTIILSVALLQPVKGAVIGLQWAFYMHGFGGEKDGAGSHHGA"
     atgccaaagg aattagggat acaagaacag gttttcggcg gtgaacatca cactggccgg        60
     gttgcccgcc ccttgtggac ggcgatgaag cgcggccttt tgggccgctg cccgaactgc       120
     ggcgaaggca agctgtttcg cggcttcacc aagaccgtcg acacctgcag cgtctgtggc       180
     gaggaaatcc atcaccatcg cgccgatgac ctgccggcct atctggtcat tgtcatcgtc       240
     ggccacatcg ttctcggtgc gttcatgggc gtggaagcga catcgacgct ctcaacctgg       300
     cagcacatcc tcatctgggt gcctctgacc atcattttgt cggttgcgct gctgcagcct       360
     gtcaaaggtg ccgtcatagg actgcaatgg gcgttctata tgcacggatt cggtggcgaa       420
     aaggatgggg cgggctccca ccacggcgcc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page