(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0843

BA000012.MLR0843     Location/Qualifiers
FT   CDS_pept        674348..675079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0843"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48346"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48346"
FT                   /db_xref="GOA:Q98LW7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW7"
FT                   /protein_id="BAB48346.1"
FT                   /translation="MTKADVDKLDKGLAAHGGRPLRPRDAATLILLDRKGDEVLVLMGR
FT                   RHAGHAFMPGKFVFPGGRTDPADSRIATATALHRDEEAKLLAGPGRTSAARARAVALSA
FT                   IRETYEEAGLLIGERAAFATDKRDWQGFVEHGVRPSLETLRFIARAITPPNRVRRFDTR
FT                   FFSAWRSDVAVELPGGGPTNELEELVWLPLAKAREADIPDITRMILDELEKRLAHDPLL
FT                   RPGGPVPFYRLVRNRFTRELL"
     atgaccaagg cggatgtcga caagctcgac aagggtctcg ccgcacatgg cggccggcct        60
     ctgcggccgc gtgatgccgc gaccctgatc ctgctcgacc gcaagggcga tgaggtgctg       120
     gtgctgatgg ggcgccgcca cgccggccac gccttcatgc ctgggaaatt cgtgtttccc       180
     ggtggccgta ccgatccggc cgacagccgc atcgcgacgg ccaccgcatt gcatcgcgac       240
     gaggaagcga agctgctggc tggtcccggc cgcaccagtg ccgcgcgggc ccgcgccgtc       300
     gccttgtccg caattcgcga gacctatgag gaagccggtc tgctcatcgg cgagagggcc       360
     gcctttgcca ccgacaagcg cgactggcaa ggtttcgtcg aacacggcgt caggccttcg       420
     ctcgaaacgc tgcgtttcat cgcgcgcgcc atcacgccgc ccaaccgggt gcgccgcttc       480
     gatacgcgct tcttcagcgc ctggcgcagc gatgtggccg ttgaactgcc gggcggcggt       540
     ccgaccaacg aacttgagga actggtctgg ctgccgcttg ccaaggccag ggaagccgac       600
     atacccgaca tcacccgaat gatcctggac gagttggaaa aacgccttgc ccatgatccg       660
     ctgctgcgtc cgggcggccc cgtgcccttc taccggcttg tccgcaaccg cttcacccgc       720
     gaacttctgt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page