(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0847

BA000012.MLR0847     Location/Qualifiers
FT   CDS_pept        676449..676907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0847"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48348"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48348"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW5"
FT                   /protein_id="BAB48348.1"
FT                   /translation="MIDSGFETTSLRMTLLLLVTFQAPAADVDRIMDAVVAIAPLAMGK
FT                   YDRNAYQSAHGIERYRPLEGAAAGAEIELRRRPGTVEVSFELPDDQALAAQVVEAIFQA
FT                   HSYQEPVIRIQPILASRSKGLDDRANPNRWWNTTGDWKKIAAPETQTA"
     atgatcgaca gcggctttga aaccacatcc ctgcgaatga cgctcctgct gctcgtgacc        60
     ttccaggccc cggcggcgga tgtcgaccgt atcatggacg cggtggttgc gatcgccccg       120
     ctggcgatgg gcaaatatga ccgcaacgcc tatcagtcag cgcacggcat cgagcgctac       180
     aggccgctcg aaggggcagc ggccggcgcc gaaatcgaat tgcgccgtcg cccgggcacg       240
     gtcgaggtgt ccttcgaatt gcccgacgac caggcgttgg ctgcccaagt cgttgaggcg       300
     attttccagg cccattccta ccaggagccg gtgatccgca tccagccgat cctcgccagc       360
     cgctccaagg gactggacga ccgcgccaat ccgaatcgct ggtggaacac caccggggac       420
     tggaaaaaga tagcggcgcc ggagacacaa accgcatga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page