(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0862

BA000012.MLR0862     Location/Qualifiers
FT   CDS_pept        688238..688540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0862"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48359"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48359"
FT                   /db_xref="InterPro:IPR021955"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV4"
FT                   /protein_id="BAB48359.1"
FT                   /translation="MMANAASMREEAETIAVKALGFVASDPELLPRFLAITGIEAHSIR
FT                   KAAGEPGFLAGVLQFILAHEPTLMRFAEETGTPPAAVGKALRALPLGDDNHERSI"
     gtgatggcaa acgcggcgtc aatgcgcgaa gaggcggaaa ccattgccgt gaaggcgctg        60
     ggcttcgtcg cctccgatcc ggagctgttg ccgcgctttc tggcgatcac cggcatagag       120
     gcgcattcga tccgcaaggc cgccggcgag ccgggctttt tggccggcgt gctgcagttc       180
     atccttgccc atgagccgac cctgatgcgc tttgccgagg aaaccggcac gccgccggcc       240
     gccgtcggca aggcattgcg cgcactgccg ctcggcgacg acaaccacga gcgttccata       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page