(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0877

BA000012.MLR0877     Location/Qualifiers
FT   CDS_pept        704670..705551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0877"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48372"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48372"
FT                   /db_xref="GOA:Q98LU1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU1"
FT                   /protein_id="BAB48372.1"
FT                   /translation="MQSVARSQSATGPDAPVSSDSTLIYRQSRWTRLTHWIWAISLFFM
FT                   LLSGLQIFNARPQLYIGKQSGFGYNNTIFEIGAVNTDAGPRGFTEIFGHRFDTTGVLGW
FT                   SGPPGNETARGFPSWATIPSYYDLGTARVVHFFFAWILTTTLIVWLVASLVNGHIRRDL
FT                   APRLDDLKRLPRDIVDHARLKFHHTREYNTLQKMAYGGVLFVLLPLMIITGLAMSPSMN
FT                   SVLPFLNEVLGGRQTARTIHFTVMLLLVGFFIIHILMILAAGPINELRSIITGWYRTDP
FT                   PAHDDKTTERSA"
     atgcaatccg ttgccagaag ccaatccgcc accggaccgg acgctcccgt gtcgagcgac        60
     agcacgctga tctaccggca gtcgcgctgg acgcggctga cgcactggat ctgggccatt       120
     tcgctgttct tcatgctgct ttccgggctg cagatattca acgcccggcc acagctctat       180
     atcggcaagc aatccggctt cggctacaac aacaccatct tcgaaatcgg cgccgtgaac       240
     accgatgccg ggccgcgcgg gttcaccgaa atcttcgggc accgcttcga cacgacgggc       300
     gtgctcggct ggtcgggtcc gccaggcaac gagacggcgc gcggcttccc gtcctgggcg       360
     accattccgt cctattatga cctcggcacc gcccgcgtcg tgcatttctt cttcgcctgg       420
     atcctgacga cgaccttgat cgtctggctg gtcgccagcc tggtcaacgg ccatatcagg       480
     cgcgatctcg ccccacgcct ggacgacctc aagcggctgc cgcgcgacat cgtcgaccac       540
     gccaggctga aattccatca cacacgcgaa tacaacacgc tgcagaaaat ggcctatggc       600
     ggcgtgctgt tcgtgctgtt gccgctgatg atcatcaccg gccttgccat gtctcccagc       660
     atgaattcgg tgctgccctt cctcaacgaa gtgctcggcg gccggcagac ggcgcgcacc       720
     atccatttca ccgtcatgct gctgctggtc ggcttcttca tcatccacat cctgatgatc       780
     ctggccgccg gcccgatcaa cgaattgcgc tcgatcatca ccggctggta ccgcaccgac       840
     cctcccgcgc atgacgacaa gacgaccgag aggagtgcct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page