(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0879

BA000012.MLR0879     Location/Qualifiers
FT   CDS_pept        705520..706362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0879"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48373"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48373"
FT                   /db_xref="GOA:Q98LU0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU0"
FT                   /protein_id="BAB48373.1"
FT                   /translation="MTTRRPRGVPDMAKFEISPNFQISRRKFLTAASLGASGIMLSGCD
FT                   AFDSQLSIGSGLRSFLENANGLTYRAQRLLAGRDALAPEFTEADIRQPQRPNGVTAPDD
FT                   DTYKGLLANNFADWRLEVSGLVEKPLSLSREQLQNMPSRTQITRHDCVEGWSCIAKWTG
FT                   TPLSLVLDQAVVKPQARYVMFHCLDTIDRSLSGDIKYYGTIDLIDARHPQTILAYGLNG
FT                   KPLPVENGAPLRVRVERQLGYKMPKYLYKIELVDGFANVGGGRGGYWEDNGYDWYGGI"
     atgacgacaa gacgaccgag aggagtgcct gacatggcga agtttgagat cagccccaat        60
     tttcagatca gtcgaaggaa attcctgacc gccgccagcc ttggcgcctc cggcatcatg       120
     ctgtcgggct gcgatgcctt cgacagccag ttgagcatcg gcagcggcct gcgcagcttc       180
     ctcgaaaacg ccaatggcct gacatatcgc gcccaacgcc tgcttgccgg ccgtgacgcg       240
     ctggcaccgg aattcaccga ggccgacatc cgccagccgc agcggccgaa cggcgttacc       300
     gcgcctgacg atgacaccta taagggcctg ctcgccaaca atttcgccga ctggcggctg       360
     gaagtctcag gcctcgtcga aaagccgctg tcgctcagcc gcgagcagct tcagaacatg       420
     ccgagccgca cccagatcac ccgccacgac tgcgtcgagg gttggagctg catcgccaaa       480
     tggaccggca cgccgctgtc gctggtgctc gaccaggcgg tggtcaagcc gcaggcgcgt       540
     tacgtcatgt tccactgcct cgacacgatc gaccgcagcc tgtccggcga catcaaatat       600
     tatggcacga tcgacctgat cgacgcccgc cacccgcaga cgatcctcgc ctatggcctg       660
     aacggcaaac cgctcccggt cgaaaacggc gctccgctgc gtgtccgcgt cgagcgccag       720
     ctcggctaca agatgccgaa gtacctctac aagatcgagt tggtcgacgg cttcgccaat       780
     gtcggcggcg gccgcggcgg ctattgggaa gacaatggct acgactggta cggcgggatt       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page