(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0884

BA000012.MLR0884     Location/Qualifiers
FT   CDS_pept        709022..709399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0884"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48376"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48376"
FT                   /db_xref="GOA:Q98LT7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LT7"
FT                   /protein_id="BAB48376.1"
FT                   /translation="MNLMAKTYFTSDHEWLRVEGGIATVGITDYAQEQLGDLVFVELPE
FT                   TGKKLTKGDTAVVVESVKAASDVYAPVDGEITEANGTLSSDPSLVNSAATGAGWLWKMR
FT                   LADESQLAGLMDEAAYKAHIA"
     atgaacctca tggcaaagac ctatttcaca tcagatcacg aatggctccg cgttgagggc        60
     ggcatcgcca ccgtcggcat caccgactac gcgcaggagc agctcggcga cctcgtcttc       120
     gtcgaactgc cggaaacggg caagaagctg accaagggcg acaccgccgt cgtggtcgaa       180
     tccgtcaagg cggcttccga cgtttacgcg ccggtcgacg gcgagatcac cgaggccaac       240
     ggcacgctgt cttccgaccc gtcgctggtc aactcggcgg caaccggcgc cggctggctg       300
     tggaagatga ggcttgccga cgaaagccag ctcgccggcc tcatggatga ggccgcctac       360
     aaagcccata tcgcctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page