(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0885

BA000012.MLR0885     Location/Qualifiers
FT   CDS_pept        709414..712227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0885"
FT                   /product="glycine cleavage system protein P"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48377"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48377"
FT                   /db_xref="GOA:Q98LT6"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LT6"
FT                   /protein_id="BAB48377.1"
FT                   /translation="MMTTALTPFSARHIGPGVNDVRAMLAVIGVPSVETLISQAVPQSI
FT                   RLDLPLTLPAPASEAEALAELSAIMAKNTVLKSFIGAGYHGVHVPPVIQRNLFENPAWY
FT                   TAYTPYQAEISQGRLEMLFNFQTLVTELTGLPVASASLLDEATAVAEAVGIALRHHRDK
FT                   RTKVAFAGTPHPQTLDVVRTRAEPLGIEIDGETIDDNTAALLVSWPDTLGVYGDHKAAI
FT                   DKARAAGALVVFIADPLGLTLTDAPAKLGADIAVGPMQRFGVPMGFGGPHAAYCAVSDR
FT                   LTRLMPGRLVGQSTDSKGRPGYRLALQTREQHIRRDKATSNICTAQALLANMATAYAIW
FT                   HGPAGLQAIAGRIHALANRLASGLKAAGVSVLGASRFDTVTVEAKGKAAEIAEAAEKTG
FT                   RLLRVLDADHVGIAFDETSTDADLDAIASLFGAKAAPSADSTVPGKPRGKEFLTQPVFN
FT                   ENKSETDMMRLLRRLADKDLALDRSMIPLGSCTMKLNAAAEMMPVSWPSIADLHPFAPA
FT                   SHSAGYRAMIGELEGWLSEITGFDAVSLQPNAGSQGEYAGLLAIRAYHRSRGEGHRTVC
FT                   LIPSSAHGTNPASAAMAGMSVVVVRCLEDGNIDMDDMRAKANEHSKNLAALMFTYPSTH
FT                   GVYEEGARHLCALIHEHGGQVYFDGANLNALVALARPADIGADVCHMNLHKTFCIPHGG
FT                   GGPGVGPIGVKAHLKPYLPGHVTEGSAHAVSAAPFGSASILPITWMYIRMMGAAGLKQA
FT                   TETAIISANYVATRLAPHFPLLYKGRHDRIAHECILDTRVLKESAGISVDDIAKRLIDY
FT                   GFHAPTMSFPVAGTLMVEPTESEPKRELDRFCEAMIAIAGEAAKVARGDWPLADNPLVN
FT                   APHTAAETLAGQWTHPYSRLEAAYPAGDADTAAKYWPPVSRIDNVAGDRNLVCSCPPLS
FT                   DYLGAAE"
     atgatgacca cagcacttac ccccttctcg gcccgtcata tcggtcctgg cgtgaacgat        60
     gtcagagcca tgcttgcggt gatcggcgtt ccctccgtcg agacgctgat cagccaggcc       120
     gtaccgcagt cgattcgcct cgacctgccg ctgaccttgc ccgcgccggc cagcgaagcc       180
     gaagcactgg ccgaattgtc ggccatcatg gcgaagaaca cggtgctgaa gagcttcatc       240
     ggcgccggct atcacggcgt ccacgtgccg ccggtcatcc agcgcaatct gttcgagaat       300
     ccggcctggt acacggccta cacgccctat caggccgaga tcagccaggg ccgtctggaa       360
     atgctgttca acttccagac cttggtcacc gaattgaccg ggctgccggt ggcatccgcc       420
     tcgctgctcg atgaggccac cgctgtcgcc gaagcggtcg gcattgcgct gcgccaccac       480
     cgcgacaagc gcaccaaggt ggcgttcgcc ggcacgccgc acccgcagac gctggatgtg       540
     gtgcgcaccc gtgccgaacc gctcggcatc gagattgacg gcgagacgat cgacgacaac       600
     accgctgccc tgctcgtctc ctggcccgac acccttggcg tctatggcga ccacaaggcc       660
     gcgatcgaca aggcccgcgc cgctggcgcg ctggtcgtct tcatcgccga tccactcggc       720
     ctgacgctga ccgatgcgcc ggcgaaactc ggcgccgaca tcgccgtcgg gccgatgcag       780
     cgctttggcg tgccgatggg ctttggcggc ccgcacgccg cctattgcgc cgtttccgac       840
     aggctgaccc ggctgatgcc cggccgcctc gtcggccagt cgaccgacag caagggccgg       900
     cccggctacc gcctggcctt gcagacgcga gaacagcata tccgccgcga caaggcgacc       960
     tccaacatct gcaccgcgca ggcgctgctc gccaacatgg caacggccta tgccatctgg      1020
     cacggcccgg ccgggctgca ggcgattgcc gggcgcatcc acgcgctggc caaccgcctg      1080
     gcgagcggcc tcaaggcggc gggcgtttcg gtgctcggcg ccagccgctt cgacacggtg      1140
     acggtggagg cgaaaggcaa ggccgcggag atcgccgaag ccgccgaaaa gaccggccgg      1200
     ttgctgcgcg tcctcgacgc cgaccatgtc ggcatcgcct tcgacgagac ctcgaccgat      1260
     gcggatctcg atgcaatcgc ttccctgttc ggtgccaagg ctgccccctc ggccgacagc      1320
     accgtccctg gcaagccgcg cggaaaagag tttctgaccc agcccgtctt caacgagaac      1380
     aagtcggaaa ccgacatgat gcgcctgctg cgccggttgg ccgacaagga tctggcgctc      1440
     gaccgctcca tgatcccgct cggatcctgc accatgaagc ttaacgcggc ggccgaaatg      1500
     atgccggtga gctggccaag catcgccgat ctgcatccct tcgcgccggc cagccattcg      1560
     gccggctatc gcgccatgat cggcgaactg gaaggctggc tgtccgaaat caccggcttc      1620
     gacgcggtca gcctgcagcc caatgccggc agccagggcg aatatgccgg cctgctcgcc      1680
     atccgcgcct atcaccgctc gcgcggcgaa gggcatcgca cggtctgcct gatcccctcc      1740
     tccgcgcatg gcaccaatcc ggcaagcgcg gcgatggccg gcatgagcgt tgttgtcgtg      1800
     cgctgcctgg aggacggtaa catcgacatg gacgatatgc gggccaaagc caacgagcat      1860
     tccaagaatc tcgccgcgct gatgttcacc tatccctcga cacatggcgt ctacgaagaa      1920
     ggcgcccgcc atctctgcgc cctgatccat gagcatggcg gccaggtcta tttcgacggc      1980
     gccaacctca acgcgctggt cgcgctcgcc cgacccgccg atatcggcgc cgatgtctgc      2040
     catatgaacc tgcacaagac cttctgcatt ccgcatggcg gcggtggccc cggcgtcggc      2100
     ccgatcggcg tcaaggcaca tctgaagcct tatctgccgg gccatgtcac agaaggctcg      2160
     gcgcatgccg tgtctgcggc accgttcggc agcgcttcca tcctgccgat cacctggatg      2220
     tatatccgca tgatgggcgc cgctggactg aagcaggcaa cggagaccgc catcatctcg      2280
     gccaactacg tggcgacacg gctcgcgccg cacttcccgc tgctctacaa gggccggcac      2340
     gatcgcatcg cgcatgaatg catcctcgac acccgcgtgc tcaaggagag cgcaggcatc      2400
     agcgtcgacg atatcgccaa gcgcctcatc gactatggct tccacgcgcc gaccatgtcg      2460
     tttccggtcg ccggcacgtt gatggtcgag ccgacggaat ccgagccgaa gcgcgaactc      2520
     gaccgcttct gcgaggcgat gatcgccatt gccggcgaag ccgcgaaagt cgccaggggt      2580
     gactggccct tggccgacaa cccgctggtc aacgcgccgc acaccgccgc cgagacactg      2640
     gccggccagt ggacccatcc ctactcgcgc ctggaagcgg cctatcccgc gggcgacgcc      2700
     gatacggcgg ccaagtactg gccgccggtg tcgcgcatcg acaatgtcgc cggcgaccgc      2760
     aatctggtct gctcctgccc gcctttgtcg gattatctgg gagcagccga atag            2814
//

If you have problems or comments...

PBIL Back to PBIL home page