(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0912

BA000012.MLR0912     Location/Qualifiers
FT   CDS_pept        736193..737155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0912"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48399"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48399"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR4"
FT                   /protein_id="BAB48399.1"
FT                   /translation="MFEGRLRLFLVWLCAALFLLPVSLAVAQQKDGMGDLKLPGISSYA
FT                   TPKSETPLALSGGGAITLSAQLTDKGTDITRGLVWRVFKPVPVNGKLPMVASAHGGSAV
FT                   FQLEPGSYLVHASYGRAGATKRITVGKEAKRESLVLDAGGLKLDAVLSGGVRIPPKKLR
FT                   FSIYEGTAEANGDRALIIPDVEPNSVVRLNAGIYHVVSTYGAVNAVIRSDIRVEAGKLT
FT                   EATVEHHAAEITMKLVREAGGEAIADTSWSLLNESGDPIKESVGAFASMVLAEGDYTII
FT                   AKNRDRIYQKDFAVVAGQNQEIEVLATEAAAMDPEEGAD"
     atgtttgagg ggcgactgcg tcttttcctg gtttggctct gcgccgcgct gttcctgctg        60
     ccggtgtcct tggctgttgc gcagcaaaag gatgggatgg gcgacctgaa actccccgga       120
     atttcgagct atgcgacgcc caagagcgaa accccgctgg cgctgagcgg cggcggcgcc       180
     atcacccttt ctgcccagct gaccgacaag ggcaccgaca tcacccgtgg cctcgtctgg       240
     cgtgttttca aacccgtacc cgtcaacggc aaattgccga tggtcgcttc cgcgcatggc       300
     ggcagtgccg tgttccagct cgagcccggc agctatctgg tccatgcctc ctatggccgc       360
     gccggcgcca ccaagcgcat cactgtcggc aaggaagcca agcgcgaaag cctcgtgctc       420
     gatgccggcg gcctgaagct cgacgcggtt ctgtccggcg gcgtgcgcat tcccccgaaa       480
     aaactgcgct tctcgatcta tgagggcacc gccgaggcca atggcgaccg cgcgctgatc       540
     attcccgatg tcgagcccaa cagcgtcgtg cggctcaatg ccggcatcta ccatgtcgtc       600
     tcgacctacg gtgcggtcaa tgcggtgatc cgctccgaca tccgcgtcga ggccggcaag       660
     ctgaccgagg ccaccgtcga gcatcacgcc gccgagatca cgatgaagct ggtgcgcgaa       720
     gccggtggcg aagccattgc cgacacgtca tggtcgctgc tcaacgaatc cggcgatccg       780
     atcaaggagt ccgtcggcgc cttcgcctcg atggtgcttg ccgagggcga ctacaccatc       840
     atcgccaaga accgcgaccg catctaccag aaggatttcg cggtcgtagc cgggcagaac       900
     caggaaatcg aggttcttgc caccgaagcg gcggccatgg accccgaaga aggcgcggat       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page