(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0971

BA000012.MLR0971     Location/Qualifiers
FT   CDS_pept        793755..795035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0971"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48443"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48443"
FT                   /db_xref="GOA:Q98LM0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM0"
FT                   /protein_id="BAB48443.1"
FT                   /translation="MREGHSTYKPKTGIERWLDGRLPLPRVVHDSFIVYPVPRNLNFAY
FT                   TFGGILTMMLGLQVATGIVLAMHYAADTTLAFNTVEKIVRDVNSGWLLRSLHANGASFF
FT                   FIAVYVHIFRGLYYGSYKAPRELLWILGCLNVLLMMAIAFIGYVLPWGQMSFWGATVIT
FT                   NFFTAIPLVGGWIQKLLLGGFAVENPTLNRFFALHYLLPFLLIGNVTLHIWALHVVGQN
FT                   NPAGIDVQSSTDVVDFTPHATIKDIFGAVMFLIVFLYFVFYLPNYLGHPDNYSAADPLK
FT                   TPSHIVPEWYFLPFYAMLRAVNFNVGPIDSKLGGVLALFGAIVVLFFVPWLDRTSVRSA
FT                   VYRPLYRRFFWLFASDVIFLGWLGSKPAEGWYVPAMQAATLFYFAFFIIVVPLIGMIEK
FT                   PLRLPNSITEVVLERNKKRRPKDRTAS"
     atgcgcgagg gccattcgac ctacaagcca aagaccggta tcgaacgctg gctcgacggc        60
     cggctgccac tgccgcgggt ggtgcatgac tccttcatcg tttatcccgt gccgcggaac       120
     ctcaatttcg cgtacacgtt cggcggcatc ctgacaatga tgctggggct acaggtcgcg       180
     accggcatcg tgttggctat gcactatgca gccgatacaa ctcttgcctt caataccgtg       240
     gagaaaatcg tacgggatgt gaactccggc tggctcttac gatccctgca tgcaaacggc       300
     gcgtcgtttt ttttcatcgc cgtctatgtc cacattttcc ggggtcttta ctacggctcc       360
     tacaaggccc cacgcgagct actttggata ctcggttgcc ttaacgtgct gcttatgatg       420
     gcgatagcct tcataggcta tgtgttgccg tggggacaaa tgtcgttctg gggcgcgacg       480
     gtgatcacta acttcttcac ggcaatcccg ctcgttggcg gatggatcca gaagctgttg       540
     ctcggtggtt tcgcagtgga aaacccaacc ctcaatcgtt tcttcgctct gcactatctt       600
     ctgccattct tgctcatcgg caatgtcact ttacacatct gggcgcttca cgtagtaggc       660
     cagaacaatc cagctgggat cgacgtgcag tcgagcacgg acgtcgttga cttcacgccg       720
     cacgccacaa taaaagatat attcggcgcg gtaatgtttc tgatcgtctt cctctatttt       780
     gtattctatt tgccaaatta ccttggccat ccggataact acagcgcggc tgacccgcta       840
     aagacgccat ctcacatcgt tcccgaatgg tactttctgc cgttctacgc catgctgcgg       900
     gcggtcaatt tcaatgtcgg accgatcgac tcaaagctcg gcggtgtgct cgccctgttc       960
     ggagccatcg ttgtgttgtt cttcgtgcca tggctggacc ggacgagcgt gcgttcggct      1020
     gtctatcgtc ctctatatag gcgcttcttt tggctattcg cctcggacgt gatctttctc      1080
     ggctggttgg gatccaaacc agctgagggc tggtacgtcc cggccatgca ggcggcgacg      1140
     ctcttctact tcgccttctt catcatcgtc gtgccgttga tcggaatgat cgaaaaacct      1200
     ctgcgactgc cgaactcgat tactgaagta gttctggaga ggaacaagaa acgacgaccc      1260
     aaagatcgca cggcgtccta a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page