(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0044

BA000012.MSL0044     Location/Qualifiers
FT   CDS_pept        complement(35797..36057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0044"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47715"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47715"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP6"
FT                   /protein_id="BAB47715.1"
FT                   /translation="MPEGLHQRHQEGIWNKRSPISMKKFFLTLAGAAVLAGSMAVAPEP
FT                   AMARHWHGHKQVCRIIVKKRVVWRHGHRRVIVERIRRCHRW"
     gtgccggaag gtttgcacca gcggcaccag gaagggatct ggaacaagag gagtccaatt        60
     agcatgaaga agttcttcct taccctggcc ggtgccgcgg tgcttgccgg atcgatggcg       120
     gttgcgccgg agccggcaat ggcgcgccat tggcacggtc acaaacaggt ctgtcgcatc       180
     atcgtcaaga agagagtggt gtggcggcac ggtcatcgca gggtaatcgt cgagcggata       240
     cggcgctgcc atcgctggta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page