(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0218

BA000012.MSL0218     Location/Qualifiers
FT   CDS_pept        complement(154097..154267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0218"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47850"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47850"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB1"
FT                   /protein_id="BAB47850.1"
FT                   /translation="MHCVTVSGASETSNVVALQWQLPLMVINITSPLSAAHEARHHKEV
FT                   ILTTACQQVLL"
     gtgcattgcg tcaccgtttc cggtgcctct gaaacctcga atgtcgtcgc cttgcagtgg        60
     cagcttccct tgatggtcat caacatcacc tctccattgt cggccgccca cgaggcaagg       120
     caccataaag aagtgatcct gacaactgcc tgtcagcagg ttctactctg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page