(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0261

BA000012.MSL0261     Location/Qualifiers
FT   CDS_pept        complement(183666..183830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0261"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47884"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47884"
FT                   /db_xref="GOA:Q98N77"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N77"
FT                   /protein_id="BAB47884.1"
FT                   /translation="MINQPRELPMTDFDRNKNSDTEHKAAIRKSLVGWAMFIAGTLIFF
FT                   AAADAVLMP"
     atgatcaatc agccaaggga gctccccatg accgattttg accggaacaa gaactccgac        60
     accgagcaca aggccgccat ccgcaagtcg ctggtcggct gggcgatgtt catcgccgga       120
     acgctgatct tcttcgccgc ggccgatgca gtgttgatgc catag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page