(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0377

BA000012.MSL0377     Location/Qualifiers
FT   CDS_pept        complement(267134..267343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0377"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47969"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47969"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ4"
FT                   /protein_id="BAB47969.1"
FT                   /translation="MRPDVHFGLWLLSRGAKQEEFRHVRVERYRQFVPDRGCVADVVRQ
FT                   QAIATKGSCAFVGVEHQRIGVRVE"
     atgcggccgg acgtccattt cgggttatgg ctgttgtcgc gcggggcgaa acaggaggag        60
     tttcgccatg tccgagttga gcggtatcgt cagtttgttc ctgatcgcgg ctgcgttgct       120
     gacgtcgtgc gacagcaagc aatcgccacc aaaggctctt gcgcctttgt cggcgttgag       180
     caccagcgaa taggcgttcg cgttgaataa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page