(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0434

BA000012.MSL0434     Location/Qualifiers
FT   CDS_pept        complement(315189..315449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0434"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48018"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU5"
FT                   /protein_id="BAB48018.1"
FT                   /translation="MSLQSARYTDVMRKPSKTPFTKLLAAETTLLSADRLLGLLKLQTD
FT                   RGDIELVMNRVVAERLMSTVVDFLQAGQGDDGPTFAVERSQ"
     gtgagtctcc aatcggcgcg ctataccgat gtgatgcgta agcccagcaa aacgcccttc        60
     accaaactgc tcgccgctga gacaaccctt ctgtccgctg atcgactgct cggattgctc       120
     aagctgcaga ccgacagggg cgatattgaa ctggtcatga atcgggtcgt cgccgagcgg       180
     cttatgtcaa ccgtcgtaga cttccttcag gctggccagg gcgacgacgg gccaacattt       240
     gcggtcgagc gttcgcaata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page