(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0435

BA000012.MSL0435     Location/Qualifiers
FT   CDS_pept        complement(315661..315882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0435"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48019"
FT                   /db_xref="InterPro:IPR008486"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU4"
FT                   /protein_id="BAB48019.1"
FT                   /translation="MSTRGTDFLHKWISKLVPKTAGADIISVADLTEKFFADAKAKGMS
FT                   STEIEEDTGSVYEAILDAIVHHDPGLAD"
     atgagcacac gcggcaccga cttccttcac aagtggattt caaaactcgt ccctaaaacg        60
     gctggcgcag atatcatctc ggttgcggac ctcaccgaga agtttttcgc ggacgccaag       120
     gccaaaggta tgagcagcac cgagatcgag gaagacaccg gcagcgtgta cgaggcgatc       180
     ctggacgcga tcgtccatca tgatcctggc ttggctgact ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page