(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0439

BA000012.MSL0439     Location/Qualifiers
FT   CDS_pept        complement(317733..318029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0439"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48022"
FT                   /db_xref="GOA:Q98MU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU1"
FT                   /protein_id="BAB48022.1"
FT                   /translation="MIPTSARRREMGALIVSILGALVGNKVIMTLFAAVVGGLYVAGGI
FT                   NRAKKDKAATAARDLAAAQDQLEMDREATAAEKQAAGMTNAQAKAEATKWAKS"
     atgatcccaa catcggcaag gcgccgtgaa atgggcgctc tcatcgtttc catcctcggc        60
     gctcttgtcg gcaacaaggt catcatgacc cttttcgccg cggtggtcgg tggcctctat       120
     gtggccggcg gcatcaaccg tgcaaaaaag gacaaggccg ccacagccgc ccgagacctt       180
     gccgcagctc aggatcaact cgaaatggac cgcgaggcga ccgccgctga aaagcaggcc       240
     gccggcatga ccaatgccca ggcgaaagcg gaggcgacca aatgggcaaa gtcttga          297
//

If you have problems or comments...

PBIL Back to PBIL home page