(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0567

BA000012.MSL0567     Location/Qualifiers
FT   CDS_pept        complement(416696..416872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0567"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48129"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48129"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI4"
FT                   /protein_id="BAB48129.1"
FT                   /translation="MPWGTVMVAPFANCGGLAYVAHVVDMRVDEFAERFQARYRFWVAQ
FT                   RRASSRRRKVPLT"
     atgccgtggg gcacggtgat ggtcgcgccg ttcgcgaact gcgggggact tgcctacgtc        60
     gcacatgtcg tcgatatgag ggtcgatgag ttcgccgaaa ggtttcaggc gcgctatcgg       120
     ttttgggtcg cccaacgccg tgcatcgtct cggcgcagga aggtcccgct gacgtag          177
//

If you have problems or comments...

PBIL Back to PBIL home page