(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0655

BA000012.MSL0655     Location/Qualifiers
FT   CDS_pept        complement(515041..515319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0655"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48203"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48203"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB0"
FT                   /protein_id="BAB48203.1"
FT                   /translation="MAVYVDAAIWRWAGHRWCHLMADDTDELHRFAAALGVKRSSYQGP
FT                   PKTSAPHYDITGFERDRAVRLGAIECSREEIVAIFRRVRVPNGKAKR"
     atggcagtct acgtcgatgc ggcgatctgg agatgggccg gccatcgctg gtgccacctg        60
     atggccgacg acaccgacga gctgcatcgt ttcgccgccg cgctgggcgt caaacgttcg       120
     tcctaccagg gaccgcccaa gacatccgct ccgcattatg acataaccgg tttcgagcgc       180
     gaccgcgcgg tgcggctcgg cgccatcgaa tgcagccgcg aggaaatcgt cgcgatcttc       240
     cggcgcgtgc gggtgcccaa tggaaaggcc aagcgatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page