(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0755

BA000012.MSL0755     Location/Qualifiers
FT   CDS_pept        complement(593635..593811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0755"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48281"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48281"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M32"
FT                   /protein_id="BAB48281.1"
FT                   /translation="MERYVEDYQKRRLTERVDIIAAINILRSQGCEYDDLIEEITKVFY
FT                   VDLDTFNEIVMAA"
     atggaacgtt atgtcgagga ctaccagaag cggcggctta ccgaacgggt cgacatcatc        60
     gccgccatca acatcttgag gtcgcagggc tgcgaatacg acgacctgat tgaggaaatc       120
     accaaggtct tctatgtcga ccttgatacc ttcaatgaaa tcgtgatggc ggcatag          177
//

If you have problems or comments...

PBIL Back to PBIL home page