(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0779

BA000012.MSL0779     Location/Qualifiers
FT   CDS_pept        complement(611887..612045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0779"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48297"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48297"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M16"
FT                   /protein_id="BAB48297.1"
FT                   /translation="MAAALQEAITKDPSKAADLTAKVQAVTTKYQGTTTLADACKAYDE
FT                   VTAAIKG"
     atggccgccg cgctgcagga agcgatcacc aaggatccgt ccaaggcagc tgacctgacc        60
     gccaaggtcc aggcggtgac aaccaagtac cagggcacca cgacactcgc cgacgcctgc       120
     aaggcgtatg acgaggtgac ggccgccatc aagggctaa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page