(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0939

BA000012.MSL0939     Location/Qualifiers
FT   CDS_pept        complement(758704..758901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0939"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48420"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48420"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP3"
FT                   /protein_id="BAB48420.1"
FT                   /translation="MLQDGARGLGRGDHPEAEEALKGSAQTATCPVMERRVSESLTHSD
FT                   MPDSAWVASVIHAKLFALPF"
     atgcttcagg atggcgcgcg agggctcggt cgaggagatc accccgaagc cgaagaagcg        60
     ctaaagggct cggcgcagac ggcgacatgt ccggtgatgg aacggcgagt ctctgaaagt       120
     ctgacgcatt cagacatgcc ggattcggcg tgggtggcgt ccgtcatcca tgcgaaattg       180
     tttgctttgc cattttga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page