(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0968

BA000012.MSL0968     Location/Qualifiers
FT   CDS_pept        complement(791636..791827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0968"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48440"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48440"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM3"
FT                   /protein_id="BAB48440.1"
FT                   /translation="MVGSMAVIRYAERNGTRRTWLMQLMARRTTKVAAVALANKTARMV
FT                   WALMTNGGRYREPDIRIG"
     gtggtcggtt ctatggcggt catccgctat gccgagcgga acggaaccag gaggacatgg        60
     cttatgcagt tgatggcgag gcgaacgacc aaggttgcag cggttgcgct ggccaacaag       120
     acagcccgga tggtttgggc attgatgaca aacggcgggc gctacaggga gccggacatt       180
     cgcataggat ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page