(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL8587

BA000012.MSL8587     Location/Qualifiers
FT   CDS_pept        complement(347894..348763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl8587"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48055"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48055"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ8"
FT                   /protein_id="BAB48055.1"
FT                   /translation="MYDQTQTTGITALPYTVVRIRAGDVANPQAVHKGTGFFYHFREGA
FT                   GNVPLIVSNKHVLVGKEWLEFDFALLDNQGKRVFGPANTFRLTKNQLPIFEHPDPTVDL
FT                   AAIPIQPIVEAMRGQGKEIFNLLLGRETIAPDNIQAILHAATSVLMVGFPSGIMDEKNN
FT                   LPVVRRGILAVNYLTDYRGETNFVVDIAAFGGSSGSPVFAFFENMLPDGSGGVTMLAQP
FT                   QVYFLGVLHSGPSMTATGKIVPVPVPTSDQIAQTQMMLHLGYCVKASRVEELVETIRAK
FT                   ISEPTASG"
     atgtacgacc aaacccagac gaccggaatt accgctctgc cctataccgt cgttcgtatc        60
     cgcgccggcg acgtcgccaa tccacaagct gtccataagg gaacaggttt cttctatcat       120
     tttcgggagg gggcgggaaa cgtacctttg atcgtttcaa ataagcacgt gcttgtcgga       180
     aaggagtggt tggagttcga ttttgcactg ctcgataatc aggggaagag ggtttttgga       240
     ccggcaaaca cgttcagatt gacaaagaac caattgccaa tctttgagca ccccgatcca       300
     accgtggact tggctgcgat tccgatacag ccaattgtgg aagcgatgcg aggacaaggc       360
     aaagagatat tcaatctact gcttggtcgc gaaaccatcg caccggacaa catccaagca       420
     atcctgcatg ccgccacgag cgtcctaatg gttgggttcc caagtggaat catggatgag       480
     aagaacaatc ttccggtcgt gcgccgagga atcctcgccg tgaactactt gaccgattat       540
     cgcggcgaga ccaactttgt cgtggacatt gcagcctttg gtggatcctc aggatcgccg       600
     gtttttgctt tttttgaaaa catgctgccg gacggcagcg gcggtgtaac catgctggct       660
     cagccgcaag tctatttctt aggcgttttg cattccggtc caagtatgac agcgacaggc       720
     aaaatcgttc cggttccggt gccgacgagc gatcagatag cgcaaaccca aatgatgcta       780
     cacctaggct attgcgtgaa ggcctctagg gtagaagagc tcgttgaaac gatccgtgca       840
     aaaatcagtg agccgacggc atctgggtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page