(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL8590

BA000012.MSL8590     Location/Qualifiers
FT   CDS_pept        complement(429196..429351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl8590"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48140"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48140"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH3"
FT                   /protein_id="BAB48140.1"
FT                   /translation="MMVSEFGHFAKRVEMDAGGIGLVRRLENEFHADDAGPQQRAPTSN
FT                   SLKFVA"
     atgatggtaa gcgagtttgg ccattttgca aaaagggtcg agatggacgc cggcgggatt        60
     ggcctggtca ggcggttgga aaacgagttc cacgctgatg acgctggccc gcaacaacgc       120
     gcgccgacat cgaattcgtt gaaatttgtc gcatag                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page