(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0042

BA000012.MSR0042     Location/Qualifiers
FT   CDS_pept        35512..35700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0042"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47714"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47714"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP7"
FT                   /protein_id="BAB47714.1"
FT                   /translation="MPATSKAQQKAAGAALSAKRGETKKSELKGASKGMYESMSEKQLE
FT                   EFAETKRKGLPEKKSKD"
     atgccagcca cctcgaaagc tcagcagaaa gccgccggcg ccgcactctc cgccaagcgc        60
     ggcgagacga aaaagagcga actcaaaggc gcttccaaag ggatgtacga atccatgagc       120
     gagaagcagc tcgaggaatt cgccgagacc aagcgcaaag ggctgccgga aaaaaagtcg       180
     aaagactga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page