(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0060

BA000012.MSR0060     Location/Qualifiers
FT   CDS_pept        46262..46513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0060"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47727"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47727"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN4"
FT                   /protein_id="BAB47727.1"
FT                   /translation="MDTIATIRHSRAAFPSEALRPSGQRGFVRRLVRVVRSLARWIDHL
FT                   LERRRGRLALLEMTDDQLKDIGISRCDAHREGIRRFWE"
     atggatacaa tagcgacaat ccgtcattcc agagccgcgt ttccaagtga ggcgctgcgc        60
     ccgtccggcc agcgaggctt tgtccgccgt ttggtgcgcg tggtcaggtc gctcgcacga       120
     tggatcgacc atttgctgga gcgccggcgc ggccgcctgg cattgctgga gatgactgac       180
     gatcagctca aggatatcgg catctcccgc tgcgatgccc atcgcgaagg catcaggcgc       240
     ttttgggaat ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page