(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0226

BA000012.MSR0226     Location/Qualifiers
FT   CDS_pept        159129..159356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0226"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47856"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47856"
FT                   /db_xref="GOA:Q98NA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA5"
FT                   /protein_id="BAB47856.1"
FT                   /translation="MRMIPGKSEVRGTHQPDEADILPVARLIIVFVMLGSFALVFAELV
FT                   RQSENMSMRPLPTASRCGDATGMPCPQRAL"
     gtgcgcatga tccccgggaa atctgaagtt cggggcacgc accaaccaga cgaggccgac        60
     atattgccgg tagcacgcct gatcatcgtc tttgtcatgc tgggtagctt cgcgctggtc       120
     ttcgccgagc ttgtgcgcca gtcggaaaac atgagcatga gaccgctgcc gacagcgtcg       180
     cgctgcggcg atgccaccgg aatgccttgc ccgcaacggg cactgtag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page