(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0269

BA000012.MSR0269     Location/Qualifiers
FT   CDS_pept        189774..189977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0269"
FT                   /product="secretion protein; SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47890"
FT                   /db_xref="GOA:Q98N72"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N72"
FT                   /protein_id="BAB47890.1"
FT                   /translation="MASKTTNPFVFLQQVRSETAKVTWPSRRETMISTVMVLAFAVIAM
FT                   IFFFSADQLMGLAIEQILGIGR"
     atggcttcga aaaccacaaa tcctttcgtc tttctccagc aggttcgctc ggagaccgcc        60
     aaggtgactt ggccgtcgcg gcgcgaaacg atgatctcga cggtgatggt tctggccttc       120
     gccgtgattg cgatgatctt tttctttagc gccgatcagt tgatgggcct cgcgatcgaa       180
     cagattctgg gcattggacg ctaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page