(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0297

BA000012.MSR0297     Location/Qualifiers
FT   CDS_pept        212079..212357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0297"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47910"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47910"
FT                   /db_xref="GOA:Q98N53"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N53"
FT                   /protein_id="BAB47910.1"
FT                   /translation="MTRSIWKGPFIDGYLLKKVDKVREGGRNEVIKMWSRRSTILPQFV
FT                   GFTFGVYNGQKHVPVSVNEDMVGHKFGEFAPTRTYYGHGADKKAKRK"
     gtgactcgtt ctatttggaa aggccccttc atcgacggct accttctcaa gaaggtggac        60
     aaggttcgtg aaggtggtcg caatgaggtg atcaagatgt ggagccgtcg ctccaccatc       120
     ctgccgcagt tcgtcggctt caccttcggt gtctacaacg gccagaagca tgttcccgtt       180
     tcggtgaacg aggacatggt cggtcataag ttcggtgaat tcgcaccgac gcggacctat       240
     tacggtcacg gcgcggataa gaaggcgaag aggaaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page