(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0510

BA000012.MSR0510     Location/Qualifiers
FT   CDS_pept        376907..377143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0510"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48083"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48083"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN0"
FT                   /protein_id="BAB48083.1"
FT                   /translation="MAGHDTRMSRIAALINPHELTYMLLDWQVWWPASHRKPETDLGAS
FT                   GNSANTDCRNRSGGADRGAGFRRCRLPGDAGRA"
     gtggccggtc atgatacccg aatgagccga atcgccgcgt tgatcaatcc gcatgaactg        60
     acctatatgc ttctcgattg gcaggtctgg tggcccgcct cgcatcgcaa gccggaaacc       120
     gatcttggag catcaggaaa cagcgcgaat actgattgcc ggaaccggtc cggcggggct       180
     gatcgcggcg ctggctttcg ccgatgccgg cttcccggtg acgctggtcg ggcctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page